CAZyme Information: MGYG000001802_01213

Basic Information

• Species: Megasphaera sp900548635
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Megasphaera; Megasphaera sp900548635
• CAZyme ID: MGYG000001802_01213
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381		42068.46	7.7774

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001802	1944008	MAG	Denmark	Europe

• Gene Location: Start: 5446; End: 6591 Strand: +

Full Sequence      

MKKPNTKSGIFLALAVLILIAVGAWFFWDRSPAAAPGKTPGQQNVQEDEAARLVKKMTPE
EKIGQLMMIGIAGTTIDDQAQRQLEYCHAGNVILFDRNMDTPQQVQNLTKKIDTTVRKKS
GVMPFIALDQEGGQVLRMRKAFPPVPSEQAIGQSGQPEQAKQWAVTTGSELKKLGINVNF
APVVDLGSQAERSYSIDPAVVTSFAHQAVAGYNQVGIWCSLKHFPGIGKVKTDPHIDGDS
VNSTKDQLIQQDLKPFENLIKSENNQKMLIMVSNVTFPALDPNLPACVSKPIMTDLLRNT
FGYQGLILSDDMEMGAMAKHYAFSDMGVMAVKAGADMVLVCHEYAHERETYDGLLKEYKN
NADFRKLVDEKVTRIVRTKLS

Enzyme Prediction     

No EC number prediction in MGYG000001802_01213.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	119	340	2.2e-50	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00933	Glyco_hydro_3	5.66e-69	58	377	1	315	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	1.15e-68	57	379	1	312	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK05337	PRK05337	2.12e-61	68	343	5	282	beta-hexosaminidase; Provisional
PRK15098	PRK15098	1.10e-10	31	337	16	317	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCC72588.1	1.30e-248	1	381	1	380
AVO26856.1	1.30e-248	1	381	1	380
AVO74039.1	1.30e-248	1	381	1	380
ALG41456.1	1.45e-245	1	381	1	380
AXB83100.1	1.61e-166	1	381	1	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	1.54e-58	55	379	9	337	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
4ZM6_A	1.29e-45	60	351	10	309	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
7VI6_A	3.31e-40	68	343	5	279	ChainA, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI6_B Chain B, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI7_A Chain A, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI7_B Chain B, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835]
3BMX_A	7.15e-37	38	380	23	394	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
4GVF_A	1.43e-36	67	342	4	280	Crystalstructure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to GlcNAc [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVF_B Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to GlcNAc [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVG_A Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVG_B Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVH_A Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) covalently bound to 5-fluoro-GlcNAc. [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVH_B Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) covalently bound to 5-fluoro-GlcNAc. [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4HZM_A Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to N-[(3S,4R,5R,6R)-4,5-dihydroxy-6-(hydroxymethyl)piperidin-3-yl]butanamide [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4HZM_B Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to N-[(3S,4R,5R,6R)-4,5-dihydroxy-6-(hydroxymethyl)piperidin-3-yl]butanamide [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0AF74	1.11e-44	67	343	6	285	Beta-hexosaminidase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=nagZ PE=3 SV=1
B4SRK3	1.85e-41	66	342	1	279	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=nagZ PE=3 SV=1
B2FPW9	5.05e-41	66	342	1	279	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=nagZ PE=3 SV=1
Q080R9	3.18e-39	67	343	4	282	Beta-hexosaminidase OS=Shewanella frigidimarina (strain NCIMB 400) OX=318167 GN=nagZ PE=3 SV=1
Q5QUZ5	4.85e-39	67	352	4	288	Beta-hexosaminidase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) OX=283942 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999611	0.000197	0.000128	0.000001	0.000001	0.000095

TMHMM  Annotations     

start	end
9	28