CAZyme Information: MGYG000001802_01223

Basic Information

• Species: Megasphaera sp900548635
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Megasphaera; Megasphaera sp900548635
• CAZyme ID: MGYG000001802_01223
• CAZy Family: GH170
• CAZyme Description: Ribosomal RNA large subunit methyltransferase K/L

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313		35058.97	6.7269

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001802	1944008	MAG	Denmark	Europe

• Gene Location: Start: 7766; End: 8707 Strand: -

Full Sequence      

MLRKNVCEIMLDTTGEGLHKRGYRKNATLAPIKETLAAAIADLGITTVRFDDGFDAAKLA
MYSRLVRVQVNASTLSEEDLANLEKNGAQMDRIDGLHNFYPRLHTGLDLDYFKAQTALLH
AHGLSVGAFVPSQKGRRAPLFEGLPTLEDHRHLDVSLAGRHLAALGVQSVFIGDDGPSDK
ELRDLAALSREETGVVVIKAKLLSREPHIQDLLSYTFTVRRDTSRDVIRTSGSRAHLDGR
IIEPDSDIFRSLHRGDITLDNADFLRYMGEVQIVKCELPPEERTNIVAKVVPNEEFLLDY
LTPGRKFRFEFIR

Enzyme Prediction     

No EC number prediction in MGYG000001802_01223.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH170	3	309	2.2e-86	0.8342857142857143

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam19200	DUF871_N	2.10e-66	8	187	61	235	DUF871 N-terminal domain. This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.
COG3589	COG3589	4.50e-58	43	310	90	357	Uncharacterized protein [Function unknown].
pfam05913	DUF871	1.01e-35	196	310	1	116	Bacterial protein of unknown function (DUF871). This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.
PRK11783	rlmL	7.58e-12	2	40	143	181	bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL.
COG0116	RlmL	8.05e-12	2	43	145	186	23S rRNA G2445 N2-methylase RlmL [Translation, ribosomal structure and biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVO27179.1	7.95e-174	39	313	86	360
ALG41767.1	1.13e-173	39	313	86	360
CCC72923.1	4.58e-173	39	313	86	360
AVO74354.1	4.58e-173	39	313	86	360
AXL21107.1	1.82e-107	40	313	87	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0O_A	2.34e-37	8	307	65	355	Crystalstructure of a conserved protein from locus EF_2437 in Enterococcus faecalis with an unknown function [Enterococcus faecalis V583]
1X7F_A	1.57e-29	41	307	113	381	Crystalstructure of an uncharacterized B. cereus protein [Bacillus cereus ATCC 14579]
3V8V_A	5.15e-07	2	40	143	181	Crystalstructure of bifunctional methyltransferase YcbY (RlmLK) from Escherichia coli, SAM binding [Escherichia coli K-12],3V8V_B Crystal structure of bifunctional methyltransferase YcbY (RlmLK) from Escherichia coli, SAM binding [Escherichia coli K-12]
3V97_A	5.15e-07	2	40	144	182	Crystalstructure of bifunctional methyltransferase YcbY (RlmLK) from Escherichia coli, SAH binding [Escherichia coli K-12],3V97_B Crystal structure of bifunctional methyltransferase YcbY (RlmLK) from Escherichia coli, SAH binding [Escherichia coli K-12]
3LDU_A	1.60e-06	2	40	149	187	ChainA, Putative methylase [Clostridioides difficile 630]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H2XHV5	2.65e-21	60	310	99	344	6-phospho-N-acetylmuramidase OS=Staphylococcus aureus (strain USA300) OX=367830 GN=mupG PE=1 SV=1
A9MHU0	1.59e-06	2	40	143	181	Ribosomal RNA large subunit methyltransferase K/L OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) OX=41514 GN=rlmL PE=3 SV=1
Q0TJB3	2.82e-06	2	40	143	181	Ribosomal RNA large subunit methyltransferase K/L OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) OX=362663 GN=rlmL PE=3 SV=1
Q31YL1	2.82e-06	2	40	143	181	Ribosomal RNA large subunit methyltransferase K/L OS=Shigella boydii serotype 4 (strain Sb227) OX=300268 GN=rlmL PE=3 SV=1
Q1RDR6	2.82e-06	2	40	143	181	Ribosomal RNA large subunit methyltransferase K/L OS=Escherichia coli (strain UTI89 / UPEC) OX=364106 GN=rlmL PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001802_01223.