CAZyme Information: MGYG000001803_00067

Basic Information

• Species: RC9 sp900546925
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900546925
• CAZyme ID: MGYG000001803_00067
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388	MGYG000001803_1|CGC2	43763.6	8.9012

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001803	2202248	MAG	Denmark	Europe

• Gene Location: Start: 71643; End: 72809 Strand: -

Full Sequence      

MKYYIIAGEASGDLHGSNLMRGLYQEDPAADIRFWGGDMMNEVYKEHQDGVGLVQDYKDG
AIIGFIQVALKARSYFEKFKRCFADISSWNPDVVILIDYPGFNFRVAAWAHNKGFKVYYY
IAPKVWASREGRIKKLKAFVDKLFIVFPFEIPYFTKKGIDFIYKGNPLIDAIDNSVALKE
SREEFLRRNSLPDSPVIALMAGSRTGEISSMMPVFMEFADKMHALPEYADYQFIVAAAPS
RSMSDYSKYVSGREAYVKVVFGQSYAVLLHAVAAVVNSGTASLETALIGTPQVVAYKGAA
INFVIAKQIIKIRFISLGNLILNRTCFRELLQFYFTPDNVLQEVLRMIEDTEYRENMLAG
YQEIRNALGGRGASAAVAKAMIEELRKR

Enzyme Prediction     

No EC number prediction in MGYG000001803_00067.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	368	7.1e-104	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	5.74e-105	1	388	2	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.85e-100	1	387	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	8.93e-72	4	369	2	360	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.57e-57	5	383	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.65e-54	1	385	2	347	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY31424.1	1.72e-111	1	384	1	372
SNV26174.1	1.72e-111	1	384	1	372
AGY53532.1	2.38e-109	1	385	1	370
QXP72147.1	1.24e-107	1	387	1	370
QXP66660.1	1.75e-107	1	387	1	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	3.48e-29	5	368	11	365	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.72e-28	5	368	11	365	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q39T49	1.53e-64	2	388	8	383	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B3E4H8	1.63e-63	2	384	8	382	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q74AT9	3.32e-63	2	387	8	382	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q2LVL8	1.78e-62	5	387	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q1D393	4.37e-55	2	385	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001803_00067.