CAZyme Information: MGYG000001803_00480

Basic Information

• Species: RC9 sp900546925
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900546925
• CAZyme ID: MGYG000001803_00480
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
646	MGYG000001803_7|CGC1	73125.62	4.7612

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001803	2202248	MAG	Denmark	Europe

• Gene Location: Start: 24220; End: 26160 Strand: -

Full Sequence      

MKFIDNLKMASAVCCSLLALGACNHEVSYTFDSSKEVSGFKVALKDINPDLPTDWTGYNY
VVLEYKITTSQRFQLGFTTDWGYNDLRVMSYVPGAWNRLAIPLKYYTELPAPAFDVAATM
NKPRYTGWINLGGQRGPLTGVDSVGVRIRKPISNPKIYIRNITLSVDDPGDAYLEKHPAI
DRFGQSIYAQYPEKVKSLEDLEKQWREEEAEEVSTERFQYSRFGGYLNSQVEATGFFRTE
QIDGKWWFVDPEGHLFLSLGVDCVSPGNGGLVRDYDKRAGMYEAIPPVDEVAPIESRAGM
AYSLSAWNQVRRFGKDWKGKANDLIIKRMDKWGMNTIANWSGRDVIELGRKAFMLSFGGI
GQDASMMGLADVYSPDFVPTVEKSISSMVAKNVDNPWLIGYFVGNEPAWINDEVRLCQII
LDGPDRPIKAALKKYLESNADTDENRVAFIYDAFDKFLETVDKVYKKYDPHHLNLGMRFA
NPDTITETLLSICGKHFDVFSFNAYMLAPDKDMLDRAYACTGKPMIVGEYHFGTVDRGLA
QALWQTDSEKDRADCYRYYTENAYAHPAFIGSGYFQWSDQDITGRFDGENYNCGLVDVTD
RPYKDMVDAMIATAECLYDVHCGTAKPFATYPESARGYELIPDIWE

Enzyme Prediction     

No EC number prediction in MGYG000001803_00480.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	140	615	2.1e-91	0.8269525267993875

CDD Domains     

MGYG000001803_00480 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXP07832.1	9.47e-284	17	645	15	643
SCM56829.1	7.27e-281	17	646	14	645
BBE17136.1	4.11e-271	27	645	51	665
AHF13634.1	2.01e-261	13	646	10	646
ASB49335.1	7.81e-244	17	645	15	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XJ9_A	1.22e-55	48	619	76	760	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]
4BQ2_A	1.27e-54	28	624	28	749	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	3.24e-54	28	624	28	749	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
5Z6P_A	4.25e-50	82	618	120	759	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	5.88e-48	127	609	383	940	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1
P48839	1.81e-34	181	624	400	919	Beta-agarase A OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000002	0.000211	0.999828	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001803_00480.