CAZyme Information: MGYG000001803_00974

Basic Information

• Species: RC9 sp900546925
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900546925
• CAZyme ID: MGYG000001803_00974
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
445	MGYG000001803_19|CGC1	50518.15	4.6489

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001803	2202248	MAG	Denmark	Europe

• Gene Location: Start: 19754; End: 21091 Strand: -

Full Sequence      

MATFKIIQDVPVKSTADLRKIAAELNEDFVLINTKPFPCELGYLSLERFAEIAEYTDADM
LYSDHYEVVTNVEGKEEIRRHPAIECQKGALRDDFDFGPVQVFKTEPFKQAVAEMDVDYS
FGAMYDLRLRMKNIVHIGEYLYTEVETDTRKSGEKQFDYVNPRNREVQIEMENICTAYLK
RIGAYIAPGFKQVELDPTAKFEVTASVVIPVFNRVRTVADAVKSALSQECDFDFNVIVVD
NHSTDGTSDVLAKIDDPRLVVIVPDRNDLGIGGCWNMAVHSEHCGTYAVQLDSDDVYKDA
TTLQKVVDVFKKEGCGMVIGSYEMTDFNMNLLPPGLIDHKEWTDDNGRNNALRINGLGAP
RAFYVPLLRKINFPNCSYGEDYAVGLRISREYRIGRIYEPIYCCRRWEGNSDAALDISKV
NANNLYKDSIRTWELEARLSLNGNN

Enzyme Prediction     

No EC number prediction in MGYG000001803_00974.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	206	334	1.4e-21	0.7470588235294118

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	5.89e-18	206	321	1	114	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04179	DPM_DPG-synthase_like	2.46e-15	207	321	1	115	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
cd00761	Glyco_tranf_GTA_type	3.02e-15	207	320	1	113	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd06433	GT_2_WfgS_like	9.69e-15	206	412	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG0463	WcaA	6.24e-13	206	406	6	211	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB47643.1	1.10e-189	9	442	36	467
QIK55484.1	1.41e-189	5	445	49	487
QIK60901.1	2.00e-189	5	445	49	487
QUT73949.1	6.40e-186	5	442	49	484
AGY52991.1	2.59e-185	5	444	49	486

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q92IF9	8.06e-07	159	304	242	392	Uncharacterized glycosyltransferase RC0461 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=RC0461 PE=3 SV=1
P33697	1.20e-06	208	328	15	131	Succinoglycan biosynthesis protein ExoO OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exoO PE=3 SV=2
Q4UM29	4.29e-06	159	304	242	392	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001803_00974.