CAZyme Information: MGYG000001803_01545

Basic Information

• Species: RC9 sp900546925
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900546925
• CAZyme ID: MGYG000001803_01545
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348	MGYG000001803_47|CGC1	39838.72	6.6562

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001803	2202248	MAG	Denmark	Europe

• Gene Location: Start: 12618; End: 13664 Strand: +

Full Sequence      

MKVHTRLKIVLRYLLPTIIVLVGAPLLQKTIDEGQSFDDDILRCVIAVDDSKTMNYPIGY
NYEMLKLYAWQTGKETDIFLGGEEYLDSLSSGAVDIVVLPSTDSLIYDKNFYASATLADS
SSWIIDGKLTASHREMNIWLSHFFVTDEHKNIVERFTPAYEPFKRASTGRKYKNISPYDA
LISKYAEELGWKREMLAALIWQESKFRIEAKSRRGAVGLMQMMPRTASRFEADNLLDPEE
NIAAAVRYLSHLQSMFRIYTEDRTELMKFTLAAYNAGEGRIRDCMNYAASIGAPNRKWSD
IVAVIPDMREDSILQQDTVKLGKFKGYETIKYVENMVRLRDAFTSISK

Enzyme Prediction     

No EC number prediction in MGYG000001803_01545.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	192	341	4.3e-25	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	1.33e-50	184	343	3	159	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	1.45e-28	193	283	1	87	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	8.89e-28	177	282	3	110	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10859	PRK10859	1.94e-25	178	335	290	442	membrane-bound lytic murein transglycosylase MltF.
COG4623	MltF	5.16e-25	178	338	271	426	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CRY96252.1	2.52e-122	1	293	1	294
AGY53417.1	2.54e-45	38	337	37	341
QZT36545.1	5.70e-33	34	346	149	474
QZE14494.1	3.93e-32	76	346	195	474
QKG79130.1	6.38e-32	83	346	192	462

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EYB_I	3.48e-08	173	281	6	115	ChainI, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7EYB_J Chain J, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7EYB_K Chain K, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7EYB_L Chain L, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_B Chain B, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_D Chain D, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_F Chain F, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_G Chain G, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_J Chain J, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_L Chain L, Peptidoglycan transglycosylase gp16 [Escherichia phage T7]
6YT5_G	3.49e-08	173	281	28	137	ChainG, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_H Chain H, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_I Chain I, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_J Chain J, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_K Chain K, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_L Chain L, Peptidoglycan transglycosylase gp16 [Escherichia phage T7]
1QSA_A	1.55e-07	178	289	453	567	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
1SLY_A	2.73e-07	178	289	453	567	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
6FBT_A	3.60e-07	180	282	451	555	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8ZWR8	1.52e-24	83	341	182	446	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
Q0I361	8.27e-20	46	338	151	443	Membrane-bound lytic murein transglycosylase F OS=Haemophilus somnus (strain 129Pt) OX=205914 GN=mltF PE=3 SV=2
B0UUK3	2.02e-19	46	338	151	443	Membrane-bound lytic murein transglycosylase F OS=Histophilus somni (strain 2336) OX=228400 GN=mltF PE=3 SV=1
B4RVK5	4.65e-19	175	342	291	453	Membrane-bound lytic murein transglycosylase F OS=Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype) OX=1774373 GN=mltF PE=3 SV=3
Q4QNV4	6.80e-19	63	345	165	451	Membrane-bound lytic murein transglycosylase F OS=Haemophilus influenzae (strain 86-028NP) OX=281310 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.920010	0.078655	0.000492	0.000203	0.000152	0.000509

TMHMM  Annotations     

start	end
9	27