CAZyme Information: MGYG000001804_00697

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; CAG-831
• CAZyme ID: MGYG000001804_00697
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474	MGYG000001804_16|CGC1	53540.15	5.5543

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001804	2176227	MAG	Denmark	Europe

• Gene Location: Start: 17033; End: 18457 Strand: +

Full Sequence      

MRRYEILVTAVAMLMVAASCKEGKGPEPYGPVPTAAQLEWQKMEYYMFVHFGPNTFTDNE
WGTGDEDPDVFAPTDLDCEQWARIAREAGMKGIILTAKHHDGFCLWPSKYSRHTVAQSSW
RNGKGDVLRELSEACDKYGLKFGVYISPWDRNHPVYGTERYNEVFAGTISEVLSEYGDVF
ELWFDGADDRQGDAPSTYRWKYFNSTAMTIQPDVVIFSDVGPGCRWVGNERGYAGETNWS
RLDVARFAPGRLAPPRDTLNCGNVHGTKWVPAEADVSIRPGWFYSPSTDSLLKSVDELME
IYYASVGRNANLLLNVPPDRSGRISPVDSARLMEFRDARTEAFHADYAKMSRAYSESVRA
NSPKYAAANAVDGRYSTYWATDDSVTSASFTVYFRRDREVSSVMIQEYIPLGQRVKEFSV
ECRLAGTGEWKEVCRGTTIGYKRIMRFPAVKASEVRFNILDSYACPLINNVAIY

Enzyme Prediction     

EC	3.2.1.111	3.2.1.51

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	34	337	3.8e-80	0.8554913294797688

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	3.16e-72	24	468	2	424	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
smart00812	Alpha_L_fucos	6.48e-42	47	335	30	326	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	2.79e-40	39	334	44	323	Alpha-L-fucosidase.
pfam00754	F5_F8_type_C	1.11e-10	362	462	9	115	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam14871	GHL6	1.14e-05	77	177	1	127	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK55326.1	1.13e-215	2	474	5	478
QIK60749.1	1.61e-215	2	474	5	478
ACU63962.1	1.02e-195	28	474	18	463
QHS60344.1	3.52e-195	28	474	24	469
ATP55161.1	3.10e-194	26	474	30	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K9H_A	9.69e-122	27	474	33	463	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
4ZRX_A	6.64e-121	32	474	31	458	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3UES_A	6.69e-111	33	472	19	474	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3EYP_A	3.22e-109	28	474	5	454	Crystalstructure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]
3UET_A	8.44e-109	33	472	19	474	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7XUR3	1.46e-122	16	474	23	476	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q8GW72	3.31e-121	26	474	31	477	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q9BTY2	2.43e-16	40	334	78	355	Plasma alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA2 PE=1 SV=2
Q5RFI5	4.29e-16	40	334	76	353	Plasma alpha-L-fucosidase OS=Pongo abelii OX=9601 GN=FUCA2 PE=2 SV=1
C3YWU0	4.02e-15	80	332	101	338	Alpha-L-fucosidase OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_56888 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000156	0.017879	0.981870	0.000031	0.000053	0.000025

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001804_00697.