CAZyme Information: MGYG000001804_01247

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; CAG-831
• CAZyme ID: MGYG000001804_01247
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336	MGYG000001804_38|CGC1	39086.86	9.6496

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001804	2176227	MAG	Denmark	Europe

• Gene Location: Start: 5849; End: 6859 Strand: +

Full Sequence      

MRRILHLKRIPGTITGAVAAMLLIALTVPNAHGQSRMTRQEYIEKYKDAAIHAMKTHGIP
ASITLAQGCLESGDGNSDLAVKANNHFGIKCHNDWKGQTYYKKDDDPGKSCFRKYRNASE
SFKDHSDFLRYRDRYAFLFDLEITDYKGWCYGLKKAGYATDPQYAERLIKIIEDYRLYRF
DREIYTMAGKNSNLLPPSPNELMKVMELSPAKNSLLYKYSRNRTIYVRNGVPYILAGDMD
TYESIAEEYNLFTKELLRYNDLRKPKELVPGTVVYLQKKKAKAQRHMEIHIAVEGDTYYD
VAQKYGVRMKKLFKYNDYKEGDILHVGDEIFLRRQK

Enzyme Prediction     

No EC number prediction in MGYG000001804_01247.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	48	177	4.1e-36	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	5.04e-40	8	194	3	200	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	1.09e-39	36	181	157	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
pfam01832	Glucosaminidase	5.92e-28	47	177	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	6.86e-27	40	181	9	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
TIGR02541	flagell_FlgJ	5.01e-20	40	172	149	290	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY53917.1	1.49e-118	17	333	7	312
QKG80574.1	5.78e-88	17	336	7	311
QUT39336.1	1.27e-86	18	333	11	301
QUT71786.1	1.27e-86	18	333	11	301
QQA10134.1	1.27e-86	18	333	11	301

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	1.81e-10	40	172	2	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	2.13e-10	40	172	3	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
5T1Q_A	2.24e-10	35	183	57	214	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3K3T_A	1.36e-09	40	172	3	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5DN5_A	9.90e-09	37	176	1	149	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	6.62e-14	55	181	65	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9KQ15	1.98e-13	38	194	160	328	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
Q9X9J3	8.10e-12	40	171	161	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9I4P4	7.84e-10	29	179	228	389	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1
Q2G222	1.91e-09	35	183	317	474	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000491	0.998692	0.000183	0.000243	0.000195	0.000181

TMHMM  Annotations     

start	end
7	29