CAZyme Information: MGYG000001805_00358

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000001805_00358
• CAZy Family: GH26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
392	MGYG000001805_6|CGC2	45190.32	6.305

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001805	1812910	MAG	Denmark	Europe

• Gene Location: Start: 23393; End: 24571 Strand: -

Full Sequence      

MINYLLINCLRLRRFSCGSVRLAVLGCLLTAAVTVDAQHALCNPSPTPEAQKVYETLWNV
YQKKTLSATVANVDWNIKEAENVHEWTGKWPVMNVFDFINFHNSKDVNPKGWIDYSDISA
AENWWKDGGLVGCMWHWNILANNGTDYTCTPGTEPGQTSFDVSKIDDTDSREYKQIIKDI
DQIAKYLGKMQDAGIPVIWRPLHEAAGNIYEFEGGKAWFWWGAKGAEPFKKLWRLMYHRL
VDEHKLKNLIWVWTSQTAPEGVVDSTWYPGDEYVDVIGRDSYSALQYPLMKEYKALSGKY
PGKIVALAECGNGDEVRMSPWSKIWKEGSRWCWFMTWYDYNYNAGQSQEHKFAGKDWWID
AFGTGVVLDRDTFKQMLGQSYKYVLVKDNQIL

Enzyme Prediction     

EC	3.2.1.78

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	43	348	1.3e-83	0.9306930693069307

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.10e-52	43	340	2	285	Glycosyl hydrolase family 26.
COG4124	ManB2	4.57e-17	158	339	142	343	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRX62597.1	3.22e-114	28	371	88	443
ARK08557.1	2.85e-91	41	371	142	450
QIK58757.1	8.04e-91	41	371	142	450
QIK53340.1	1.60e-90	41	371	142	450
AET14832.1	7.74e-89	36	371	104	429

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HF2_A	9.68e-86	41	370	45	353	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6D2X_A	2.99e-76	41	375	4	336	Crystalstructure of the GH26 domain from PbGH26-GH5A endo-beta-mannanase/endo-beta-glucanase from Prevotella bryantii [Prevotella bryantii B14]
6D2W_A	6.67e-72	41	375	95	427	Crystalstructure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14],6D2W_B Crystal structure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14]
3WDQ_A	1.22e-50	43	371	36	350	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
3ZM8_A	4.98e-44	36	339	140	418	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49425	3.93e-52	41	339	146	431	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
G2Q4H7	5.77e-47	39	339	172	447	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	2.04e-39	48	337	31	319	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P55297	1.63e-37	33	337	150	430	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
P55298	2.20e-37	33	337	148	428	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.060430	0.926847	0.011134	0.000951	0.000306	0.000289

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001805_00358.