CAZyme Information: MGYG000001805_00366

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000001805_00366
• CAZy Family: GH5
• CAZyme Description: Endoglucanase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399	MGYG000001805_6|CGC3	45543.37	5.8243

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001805	1812910	MAG	Denmark	Europe

• Gene Location: Start: 36443; End: 37642 Strand: +

Full Sequence      

MKTKLRIYWLLTLVFAVMLCHAQKTARQWNSEVTAGWNLGNQFECSAPGQDGESMAIGEP
DGADNAETAWGNPVVTKKTIKAVHDAGFNAIRIPVRWQCHITNPAAMSISKTWMDRIKEV
IDWCLEYDLKVIVNVHHDKWLESRPFYANKEENCQKLALLWMNIANELGKYDYRVAFAGT
NEVHVPDNWGKPTAENLDVQNAYNQTFIDIVRATGGNNTKRHLIVQTYVCNADFGLYNGD
FIIPKDIDGNGNDYMSVELHFYNPWEYAGSGECYYWGEPYKQYGKASQSDETTMINYFDK
LANEWGSKGLGIVIGEWGLTDHYKGSEADRMHENMTYYCKTLVSEARKRGFSTFIWDNNR
FGNGADMFGIFDRNKNMEIKADWIIKGIKEGIAESAKPM

Enzyme Prediction     

No EC number prediction in MGYG000001805_00366.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	67	359	3.5e-85	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	6.92e-42	67	359	16	269	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	2.06e-18	28	387	46	388	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGH14046.1	2.44e-213	22	391	7	375
AGH14127.1	8.84e-213	23	391	23	390
AGB29444.1	8.85e-211	25	391	38	403
QVJ82263.1	4.46e-209	22	391	7	375
ADE83642.1	4.46e-209	22	391	7	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PZ7_A	5.65e-57	25	374	8	320	GH5-4broad specificity endoglucanase from Clostridium acetobutylicum [Clostridium acetobutylicum ATCC 824]
5OYC_A	7.03e-57	23	376	42	378	GH5endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYC_B GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYD_A GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYD_B GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYE_A GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYE_B GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107]
3NDY_A	2.88e-56	26	396	12	345	Thestructure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDZ_A The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans]
6HA9_A	5.36e-56	23	376	42	378	Structureof an endo-Xyloglucanase from Cellvibrio japonicus complexed with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107],6HA9_B Structure of an endo-Xyloglucanase from Cellvibrio japonicus complexed with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107],6HAA_A Structure of a covalent complex of endo-Xyloglucanase from Cellvibrio japonicus after reacting with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107],6HAA_B Structure of a covalent complex of endo-Xyloglucanase from Cellvibrio japonicus after reacting with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107]
1EDG_A	3.86e-55	36	388	32	371	SingleCrystal Structure Determination Of The Catalytic Domain Of Celcca Carried Out At 15 Degree C [Ruminiclostridium cellulolyticum H10]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P28623	1.47e-54	26	396	43	376	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
P17901	1.86e-53	36	388	57	396	Endoglucanase A OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCA PE=1 SV=1
O08342	1.98e-52	25	392	39	399	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
P28621	4.92e-52	25	377	41	359	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
P10477	5.77e-49	32	373	63	367	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000228	0.999094	0.000222	0.000148	0.000136	0.000130

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001805_00366.