CAZyme Information: MGYG000001805_01046

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000001805_01046
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
605	MGYG000001805_37|CGC1	66669.85	4.6157

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001805	1812910	MAG	Denmark	Europe

• Gene Location: Start: 11864; End: 13681 Strand: -

Full Sequence      

MHKLLLTFAFFGATLTASAQNGDYDWPSATQNIPAFPTAEGFGKFATGGRGGRVVTVTNL
EDDPTTPPEGSLRWALAQYPDEPITVVFNCSGWIILKDVLRVTRTAGLTIAGQTAPGEGI
TLYPRMFSINGAKNIIVRNMRFRAGSHGWDGSDLIAGAELVDQALCAENSEQVIFDHCTF
GWSAEEIINNQCSHFHTYQYCLLHEGLYDAGHHKGSARSFGAQWGGSQSTFHHNMLAHNY
SRSPRFQGARDDDFIVYDEFVNNVNYNWGKVNACYGGENNAPSPRYQGHQINFMNNYWKP
GPATIKGNSSGKHNFMRPTAGTYVSEWYLSGNVLEGRPELNDDNVAGVQVDGDASKVKFV
DEFIVPSKFFPEYKFDLAAYTMRDKLETAEEAYQTVLEKVGTINRDAIEKRIVEEARTGT
ATYGGSWQNGGKYGIIDDQTDAEMVKQESGFSIFPDAPEPIYREDGFDSDGDGMPDEWER
ANGFDPANAADGNYINAEGYTALEKYLASIMGEEINGEFATPTSIRTEHAVKFDLTVEQG
SLKVVGGKGVERLHVFDEAGACRLVTGLTEGENTVDVSFLPNGVYIAWVTDADGYRNAVK
FIKNM

Enzyme Prediction     

No EC number prediction in MGYG000001805_01046.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	91	298	6.5e-54	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3866	PelB	4.93e-10	29	270	24	260	Pectate lyase [Carbohydrate transport and metabolism].
smart00656	Amb_all	6.06e-06	94	270	4	168	Amb_all domain.
pfam18884	TSP3_bac	0.003	468	489	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD41735.1	3.35e-137	28	521	738	1213
QUT77860.1	1.01e-136	31	603	416	969
ANU63102.1	5.43e-133	28	519	735	1213
ASB38821.1	5.43e-133	28	519	735	1213
QQR09559.1	5.43e-133	28	519	735	1213

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FI2_A	9.90e-07	40	268	46	251	VexL:A periplasmic depolymerase provides new insight into ABC transporter-dependent secretion of bacterial capsular polysaccharides [Achromobacter denitrificans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B297	1.24e-37	29	513	16	413	Probable pectate lyase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyC PE=3 SV=1
B0XMA2	3.86e-36	29	511	17	415	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
Q4WL88	5.28e-36	29	511	17	415	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
A1DPF0	7.22e-36	29	511	17	415	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
B8NQQ7	1.61e-34	30	511	17	414	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000201	0.999147	0.000166	0.000165	0.000151	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001805_01046.