CAZyme Information: MGYG000001806_00140

Basic Information

• Species: Prevotella sp900553965
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900553965
• CAZyme ID: MGYG000001806_00140
• CAZy Family: PL4
• CAZyme Description: Rhamnogalacturonate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
630	MGYG000001806_2|CGC2	69079.75	6.6113

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001806	3097082	MAG	Denmark	Europe

• Gene Location: Start: 75545; End: 77437 Strand: +

Full Sequence      

MKRLFTTACMAVALTAAAAQDDVKLTKSGMSAAMDNGLVKVAIGTDARIKNMTYKGGSNL
MGSNGIYFDYTADKNRALSPSKMEVVRNTPEMCEVLYTNTDGDLQFQQGFIMRKGESGLY
VYVIANGTPTSSSVKLKETRVCVRLASTFLNGYVDDSMNGKIPSNSAMATAEKSENTIQD
ATYRLADGSIYTKYNWANYCERDSVHGLMNTNTGVWNIPCSYEWMNGGPLKQELTVHATS
KSPITIQMLQGEHLGAEAQYYQDGERKIYGPFFIYVNSGTQEEMIADAKAQAHAKRQEWP
FAWFENELYPLDRSTVTGRLNITTGQPQDSIRLILAEPGTDPYLQGKGYIYWGDTDKDGS
FTIRNVRKGSYTLYGYAMKGEITDELQVADIVVDGETTDLGTVKWAPATYEHKLWQIGEN
NRMSDGFCMSDAARAYGLWEEVPATLNYIIGESNPATDWYYAQTKNGTWTVTFDLDETYS
GKAYLTASAAGATNKPKVAVAINGGNSKTWSFGTNDAAIYRSAVLGGRHWLQTHSFPASA
LKKGRNTITFTMSGISKNGGVMWDCIKLEAGAKIVPSGITAVNSVADDAPVEIFTLGGVR
VGTFRSFGDVRLDKGVYIFRQGGKSGKVSF

Enzyme Prediction     

No EC number prediction in MGYG000001806_00140.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL4	22	566	6e-134	0.9981851179673321

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10317	RGL4_C	5.92e-41	415	569	1	161	C-terminal domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
cd10320	RGL4_N	9.91e-38	23	282	1	262	N-terminal catalytic domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold; the middle and C-terminal domains are both putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
pfam14683	CBM-like	1.02e-33	414	568	2	157	Polysaccharide lyase family 4, domain III. CBM-like is domain III of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain possesses a jelly roll beta-sandwich fold structurally homologous to carbohydrate binding modules (CBMs), and it carries two sulfate ions and a hexa-coordinated calcium ion.
cd10316	RGL4_M	3.63e-18	312	402	1	91	Middle domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle domain represented by this model and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
pfam14686	fn3_3	2.05e-09	334	399	10	74	Polysaccharide lyase family 4, domain II. FnIII-like is domain II of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain displays an immunoglobulin-like or more specifically Fibronectin-III type fold and shows highest structural similarity to the C-terminal beta-sandwich subdomain of the pro-hormone/propeptide processing enzyme carboxypeptidase gp180 from duck. It serves to assist in producing the deep pocket, with domain III, into which the substrate fits.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH93641.1	5.81e-134	17	578	42	589
BAV08848.1	5.97e-111	10	570	37	595
APC39134.1	1.06e-105	21	570	3	563
QOL14617.1	4.10e-99	4	568	7	568
AUH06334.1	1.89e-96	28	569	37	577

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8RJP2	6.66e-92	23	568	29	573	Rhamnogalacturonate lyase OS=Dickeya dadantii (strain 3937) OX=198628 GN=rhiE PE=1 SV=1
B8N5T6	8.82e-22	98	492	112	558	Probable rhamnogalacturonate lyase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rglB PE=3 SV=1
Q2U5P7	9.46e-22	97	577	114	665	Probable rhamnogalacturonate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rglC PE=3 SV=1
Q5AZ85	4.76e-21	98	458	111	503	Rhamnogalacturonate lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rglB PE=2 SV=2
A5ABH4	8.66e-20	106	549	120	632	Probable rhamnogalacturonate lyase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rglB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000468	0.998607	0.000283	0.000211	0.000213	0.000196

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001806_00140.