CAZyme Information: MGYG000001806_00808

Basic Information

• Species: Prevotella sp900553965
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900553965
• CAZyme ID: MGYG000001806_00808
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303		35470.36	10.1326

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001806	3097082	MAG	Denmark	Europe

• Gene Location: Start: 43881; End: 44792 Strand: -

Full Sequence      

MLRYIIMIGLFAVSSCLSAQMKWNQAYQQYINQYKDLAIEQMLKYRIPASITLAQGVFES
GAGKSSLARRGNNHFGIKCHGWRGATVYYDDDARNECFRAYRNAYESYEDHSRFLAGSQR
YSSLFRLSPTDYKGWARGLKAAGYATNPRYADKLIELIQLYRLYEYDRAKGYDKFFARRS
KDNSVNGQALHEIFQFNDNYYVKARAGDTFKSIAREVGISYRSLARYNERDRRDVLDEGD
IIYLKKKRKKAPKSYKGRVHVVREGESMYSIAQLYGIRLKNLYKLNHFPPYYQIRVGDGL
RLR

Enzyme Prediction     

No EC number prediction in MGYG000001806_00808.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	36	163	4.6e-32	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF038016	sporang_Gsm	3.07e-39	28	167	161	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
COG1705	FlgJ	1.32e-34	28	172	44	193	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	1.85e-30	20	173	1	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	1.92e-23	35	163	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
TIGR02541	flagell_FlgJ	2.45e-22	47	159	168	291	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ81211.1	8.55e-155	1	303	1	303
ADE83099.1	2.45e-154	1	303	1	303
VEH15664.1	2.84e-142	10	302	12	305
BCS86660.1	8.66e-142	19	302	2	287
ALO49150.1	1.29e-140	17	302	17	304

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	4.53e-12	47	158	21	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	5.39e-12	47	158	22	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	3.57e-11	47	158	22	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
3FI7_A	1.20e-08	28	167	31	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN5_A	5.30e-08	47	159	23	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.31e-14	44	167	65	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P37710	2.79e-14	49	286	202	457	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q9X9J3	2.64e-11	28	159	161	303	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9KQ15	2.84e-08	30	185	164	328	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
P58231	6.29e-08	47	159	169	292	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002092	0.319398	0.678044	0.000150	0.000147	0.000153

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001806_00808.