CAZyme Information: MGYG000001806_02050

Basic Information

• Species: Prevotella sp900553965
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900553965
• CAZyme ID: MGYG000001806_02050
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325		37076.98	7.9815

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001806	3097082	MAG	Denmark	Europe

• Gene Location: Start: 2948; End: 3925 Strand: +

Full Sequence      

MKRKLILLTIMLATAAGIHAADKYDNPDTIVVSRDGTGEFRTISEAIEVCRAFMDYHKVI
YVKRGTYKEKLIVPQWLTNIEILGEDRDATVITYDDHANIANPATGRGIGTFRTYTVKVE
GNSITFRNITIENNAARLGQAVALHTEGDRLVFVNCRLLGHQDTVYTGVAGTRLLFRDCY
IEGTTDFIFGPSTAWFENCEIRSRADSYITAASTPQDRPYGYIFSHCRLTADANVTKVYL
GRPWRDYGYTLFINCEMGRHIRPEGWHHWQKERQKTARYMEYGNSGEGAATDRRATWTRQ
LTKKEAAKITMEEVFSINDKWTPEI

Enzyme Prediction     

No EC number prediction in MGYG000001806_02050.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	30	315	4.2e-103	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	1.08e-80	30	310	2	290	Pectinesterase.
PLN02773	PLN02773	7.31e-72	32	311	9	292	pectinesterase
COG4677	PemB	3.09e-69	27	318	80	405	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02197	PLN02197	2.08e-62	29	309	276	562	pectinesterase
PLN02682	PLN02682	4.44e-60	19	306	60	352	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ81978.1	2.56e-183	1	323	1	322
ADE82952.1	2.56e-183	1	323	1	322
BCS84477.1	1.66e-168	3	325	2	325
AGB28242.1	2.31e-163	4	323	3	323
QJR97878.1	3.52e-159	11	324	4	319

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	3.60e-44	31	297	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.05e-43	30	297	9	281	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	1.38e-36	30	294	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	7.42e-36	30	294	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	1.97e-32	33	325	12	341	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	2.03e-51	32	306	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q5MFV6	5.07e-51	29	309	276	562	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
P41510	6.64e-51	29	323	272	569	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
O80722	5.11e-50	31	299	278	554	Pectinesterase 4 OS=Arabidopsis thaliana OX=3702 GN=PME4 PE=2 SV=1
Q8GX86	1.02e-48	18	323	243	555	Probable pectinesterase/pectinesterase inhibitor 21 OS=Arabidopsis thaliana OX=3702 GN=PME21 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000286	0.999068	0.000170	0.000159	0.000146	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001806_02050.