CAZyme Information: MGYG000001807_00334

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001807_00334
• CAZy Family: PL8
• CAZyme Description: Chondroitinase-AC

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
686	MGYG000001807_11|CGC1	77651.3	7.3178

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001807	2264331	MAG	Denmark	Europe

• Gene Location: Start: 25117; End: 27177 Strand: +

Full Sequence      

MKLKTFSLLLLAALLAVTGLDVAAQDADFQTIYQRLYERSLDKNPSKTSIDKLLQQLTPE
GAFEGIDYHATDGSPRKHVQSLITLARAYQHPENPYYHSHQLRDSYLKSLNFWIDTDHQA
KNWWYRYIPYPKELSTGIILMSREIEQDTTLFDKCIAYLRWSYETARPNHMTGANAADII
MGSFAASILTRNDAQMRDFQQRMTHLLTIQPVEGIQPDYLFAQHCGSGRQLYFTSYGKEF
VNSVLNYLELCQGTRYQSPGLELLEKLFVEGVQWIFYDRQYDPNNAGRYIHTNQYSEAVR
QLAERVCRLSTPDMKPRTEQALRRIAGENSLEGNRMFWRFDYMVHRRTGYMTSSRMTSTR
TVGNEAGNGDGNFNYYASNGVNYLFVTGREYDRNFFRKFNNRQYPGITAEQDDAPLPIPD
WGEGGNNGNSYAGGVSDSIYGACGMLLDRRGLQAHKAWFYFDKEYICLGAGIRNPEGKAD
VFTTLNQCNSDGEVLYARKGKVSTLTGETARVQADWVIHGRTGYFNLQRGAQYVIACDTA
LFSLNVNHGTRPRDGQYAYAIVPGLSDAPAAARYAKQLPVKILANSETVQAVCHQTLGIT
EALFYQPGELKLDNGDLIRTDTPCALLWDEGKQKLSVANPRCESDNPASIRVTLVRNGHP
VEVSFDMPQQESAGRSVAKFVSLPQK

Enzyme Prediction     

No EC number prediction in MGYG000001807_00334.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	335	564	4.7e-70	0.9879518072289156

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01083	GAG_Lyase	1.81e-123	20	640	10	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam02278	Lyase_8	1.92e-63	334	566	1	252	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam08124	Lyase_8_N	5.33e-18	26	257	15	249	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam02884	Lyase_8_C	9.33e-13	583	640	1	59	Polysaccharide lyase family 8, C-terminal beta-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV42606.1	0.0	7	678	4	675
QBJ18582.1	0.0	4	676	2	675
QPH58887.1	0.0	4	676	2	675
QMI79989.1	0.0	4	676	2	675
QYS87390.1	2.79e-153	19	657	12	652

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1HM2_A	9.00e-83	19	677	18	697	ACTIVESITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HM3_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-Oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus],1HMU_A ACTIVE SITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HMW_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus]
1CB8_A	1.09e-82	39	677	22	675	CHONDROITINASEAC LYASE FROM FLAVOBACTERIUM HEPARINUM [Pedobacter heparinus]
2WCO_A	1.84e-18	333	668	397	725	Structuresof the Streptomyces coelicolor A3(2) Hyaluronan Lyase in Complex with Oligosaccharide Substrates and an Inhibitor [Streptomyces coelicolor A3(2)],2WDA_A The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase in Complex with Chondroitin sulphate [Streptomyces violaceoruber]
2X03_A	1.84e-18	333	668	397	725	TheX-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase Y253A mutant [Streptomyces coelicolor A3(2)],2X03_B The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase Y253A mutant [Streptomyces coelicolor A3(2)]
6F2P_A	9.10e-18	119	605	119	662	Structureof Paenibacillus xanthan lyase to 2.6 A resolution [Paenibacillus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59288	4.93e-82	19	677	18	697	Chondroitinase-AC OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=cslA PE=1 SV=1
Q9AQS0	2.56e-11	80	669	98	751	Xanthan lyase OS=Bacillus sp. (strain GL1) OX=84635 GN=xly PE=1 SV=1
Q8A2I1	9.83e-08	430	640	708	931	Chondroitin sulfate ABC exolyase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=chonabc PE=1 SV=1
C5G6D7	1.70e-07	430	640	708	931	Chondroitin sulfate ABC exolyase OS=Bacteroides thetaiotaomicron OX=818 GN=chonabc PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000238	0.999111	0.000184	0.000153	0.000147	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001807_00334.