CAZyme Information: MGYG000001807_00488

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001807_00488
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383	MGYG000001807_18|CGC1	43943.09	9.3536

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001807	2264331	MAG	Denmark	Europe

• Gene Location: Start: 10600; End: 11751 Strand: -

Full Sequence      

MKYYLIVGEASGDLHASHLMAALKQEDPGADFRFFGGDLMSAVGGTRVKHYRELAYMGFI
PVLMHLRTIFANMKRCKDDIVAWQPDVVILVDYPGFNLNIAKFVRAHTHIPVYYYISPKI
WAWKEYRIKHIKRDVDELFSILPFEVDFFEGKHRYPIHYVGNPTVDEVTAFSSAYDESRE
AFLQKNGLDDRPIIALLAGSRRQEIKDNLPDMLRAASSFPDYQLVLAGAPGIAPEYYAQY
VGEAKVKILFNQTYPLLRHAKAALVTSGTATLETALLRVPQVVCYHTPIGKIIAFLKRHI
LKVRYISLVNLIADREVVKELVADLMTVEQIRDELRRILYDATYRQRMLEGYDYMAMRLG
EAGAPIRAARQMVKLLRQKDRNH

Enzyme Prediction     

No EC number prediction in MGYG000001807_00488.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	357	6e-114	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	4.69e-108	1	381	2	380	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	5.17e-97	1	376	2	378	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.58e-74	4	322	2	322	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	8.46e-61	5	375	10	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.90e-50	1	329	2	307	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ48683.1	5.90e-232	1	376	1	376
QUT45721.1	9.75e-231	1	376	1	376
QPH59250.1	2.57e-228	1	380	1	380
AVM56429.1	3.79e-228	1	379	1	379
QMI80442.1	1.04e-227	1	380	1	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	9.98e-33	5	324	11	330	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	2.64e-32	5	324	11	330	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	5.66e-70	2	376	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
B3E4H8	1.20e-61	2	378	8	382	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q6ALW0	1.00e-60	5	369	14	379	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
Q39T49	1.21e-57	2	379	8	383	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q2LVL8	3.28e-57	5	380	8	382	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001807_00488.