CAZyme Information: MGYG000001807_01248

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001807_01248
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381	MGYG000001807_75|CGC1	43202.44	7.1831

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001807	2264331	MAG	Denmark	Europe

• Gene Location: Start: 4439; End: 5584 Strand: -

Full Sequence      

MKTTHVILTLFASVLLASCGNGKQASVMEEPSLKDAFGDKFLVGVAINEYQSSGRDTASV
KIIKKHFNSIVAENCMKCANIHPEEDRYNFEQADQFVKFGQENNMAIIGHCLIWHSQLAP
WFCVDQKGNNVSAEVLKQRMKDHITTIVSRYKGKIKGWDVVNEAIMEDGSYRKTKFYEIL
GEEFIPLAFQYAHEADPNAELYYNDYGMNVPGRRDAVVKLVNSLKAKGLRIDAVGMQGHM
GMDYPTIEDFETSMLAFAGTGVKVMITEWDMSALPTVKRSANISDTVSFRKAMNPYPDAL
PDSVSAVWNARMKAFFNLFLKHADIVERVTAWGVTDGDSWKNNFPVRGRKEYPLLFDRNY
EMKPFLKELINENKKTENQPK

Enzyme Prediction     

No EC number prediction in MGYG000001807_01248.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	32	371	2.7e-105	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00331	Glyco_hydro_10	2.05e-122	33	364	1	303	Glycosyl hydrolase family 10.
smart00633	Glyco_10	6.79e-109	76	364	1	258	Glycosyl hydrolase family 10.
COG3693	XynA	7.32e-93	39	370	32	338	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU00906.1	2.30e-208	1	370	1	371
QUT92911.1	8.38e-208	1	372	1	370
ALJ61519.1	2.40e-207	1	372	1	370
QRQ48270.1	2.47e-204	1	370	1	368
QUT46123.1	2.47e-204	1	370	1	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UQY_A	3.10e-95	29	363	23	359	XylanaseXyn10B mutant (E262S) from Cellvibrio mixtus in complex with xylopentaose [Cellvibrio mixtus],1UQZ_A Xylanase Xyn10B mutant (E262S) from Cellvibrio mixtus in complex with 4-O-methyl glucuronic acid [Cellvibrio mixtus],1UR1_A Xylanase Xyn10B mutant (E262S) from Cellvibrio mixtus in complex with arabinofuranose alpha-1,3 linked to xylobiose [Cellvibrio mixtus],1UR2_A Xylanase Xyn10B mutant (E262S) from Cellvibrio mixtus in complex with arabinofuranose alpha 1,3 linked to xylotriose [Cellvibrio mixtus]
4PMU_A	3.11e-95	32	370	2	350	Crystalstructure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306],4PMU_B Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306],4PMU_C Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306],4PMU_D Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306],4PMU_E Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306],4PMU_F Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306]
4PMV_A	3.21e-95	32	370	3	351	Crystalstructure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P43212) [Xanthomonas citri pv. citri str. 306],4PMV_B Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P43212) [Xanthomonas citri pv. citri str. 306]
2CNC_A	1.12e-94	29	363	32	368	Family10 xylanase [Cellvibrio mixtus]
6FHE_A	3.31e-93	31	364	11	333	Highlyactive enzymes by automated modular backbone assembly and sequence design [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49942	5.98e-182	1	376	1	375	Endo-1,4-beta-xylanase A OS=Bacteroides ovatus OX=28116 GN=xylI PE=2 SV=1
P48789	3.20e-129	25	370	18	365	Endo-1,4-beta-xylanase A OS=Prevotella ruminicola OX=839 GN=xynA PE=3 SV=1
D5EY13	2.61e-76	1	363	1	360	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P45703	9.42e-76	31	371	6	329	Endo-1,4-beta-xylanase OS=Geobacillus stearothermophilus OX=1422 GN=xynA PE=1 SV=1
Q12603	1.02e-74	7	370	8	350	Beta-1,4-xylanase OS=Dictyoglomus thermophilum OX=14 GN=xynA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000090	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001807_01248.