CAZyme Information: MGYG000001807_01348

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001807_01348
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
300		34569.66	9.2201

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001807	2264331	MAG	Denmark	Europe

• Gene Location: Start: 5788; End: 6690 Strand: +

Full Sequence      

MNIIAVVVTYNRQELLKRNIHCLRQNKPLTSIIVVNNGSTDSTAAWLDRQSDLTVIHQSN
VGGSGGFYTGMQHAYQLGADWVWCMDDDVFPRADCLEHLLAEAGRKDVGILAPRRLMEGK
VFTHDFQEYNLTNPFSSMYGKKLSKQTITAPTEVKGTAFEGPFIRREVIGKIGLPNKELF
IFCDDTDYCLRTVLAGFKILYVPSALMDKEKFFSNDTWSERSKKKKWKRYYQVRNSTYLN
HHYGRNWAVRYLRGFNGVIGYILVAFFTCPFSDAWQWGDIARLWKAYCDGLHERLGIMNK

Enzyme Prediction     

No EC number prediction in MGYG000001807_01348.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	5	147	6.3e-25	0.8470588235294118

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04185	GT_2_like_b	7.58e-71	5	239	1	202	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	3.30e-39	1	269	3	267	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd02526	GT2_RfbF_like	2.66e-33	5	239	1	236	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
cd04186	GT_2_like_c	1.72e-28	6	207	2	162	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	4.33e-21	6	149	3	149	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ49134.1	1.39e-186	1	298	1	298
QUT44872.1	1.57e-185	1	298	1	298
QEW34764.1	5.43e-184	1	299	1	299
ALK83396.1	5.43e-184	1	299	1	299
QQY42096.1	5.43e-184	1	299	1	299

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FIX_A	2.53e-07	41	235	230	436	CrystalStructure of GlfT2 [Mycobacterium tuberculosis H37Rv],4FIX_B Crystal Structure of GlfT2 [Mycobacterium tuberculosis H37Rv],4FIY_A Crystal Structure of GlfT2 Complexed with UDP [Mycobacterium tuberculosis H37Rv],4FIY_B Crystal Structure of GlfT2 Complexed with UDP [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R5Z2	1.85e-13	5	196	9	205	Galactofuranosyltransferase GlfT1 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glfT1 PE=1 SV=1
P9WMX2	6.44e-13	2	196	4	202	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=glfT1 PE=3 SV=1
P9WMX3	6.44e-13	2	196	4	202	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glfT1 PE=1 SV=1
P37782	1.72e-08	2	207	4	204	dTDP-rhamnosyl transferase RfbF OS=Shigella flexneri OX=623 GN=rfbF PE=3 SV=2
O53585	1.37e-06	41	235	210	416	Galactofuranosyltransferase GlfT2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glfT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
255	277