CAZyme Information: MGYG000001807_01528

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001807_01528
• CAZy Family: CE15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
307		34281.19	5.2422

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001807	2264331	MAG	Denmark	Europe

• Gene Location: Start: 42; End: 965 Strand: +

Full Sequence      

MPRECIRAELADDTLRVTVTVGDEALTLVSPILYPEGDGPFPAIIGIGRGSGSLPSELFS
RRNIAQITFDFRQVMSHTQTRGQEPINRLYPDQTEMGAYAAWSWGISRLIDGLEQLGDRS
RIDLKHLAVSGCSFAGKMALFAGAFDERIALTIAQEPGGGGAAAWRVSETLGEVETLGRT
SHAWFMESMFRFKEENVNRLPFDHHELCAMVAPRALLVLGNPDYKWLADESGYVSCRAAR
KVWERFGIADRMGFSIVGSHPHCMLPQEQYPEVEAFIDKFLLGKPADTMVLKAPLFEKVD
WEKWVAW

Enzyme Prediction     

No EC number prediction in MGYG000001807_01528.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE15	23	282	7.5e-71	0.8029739776951673

CDD Domains     

MGYG000001807_01528 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ59535.1	9.67e-175	6	305	104	404
QUT89422.1	1.95e-174	6	305	104	404
EFV29552.1	1.47e-159	3	307	100	405
QUT46099.1	1.47e-159	3	307	100	405
QRQ48279.1	1.47e-159	3	307	100	405

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4G4G_A	1.78e-60	2	306	99	405	Crystalstructure of recombinant glucuronoyl esterase from Sporotrichum thermophile determined at 1.55 A resolution [Thermothelomyces thermophilus ATCC 42464]
3PIC_A	3.27e-60	6	307	70	369	ChainA, Cip2 [Trichoderma reesei],3PIC_B Chain B, Cip2 [Trichoderma reesei],3PIC_C Chain C, Cip2 [Trichoderma reesei]
4G4I_A	4.96e-60	2	306	99	405	Crystalstructure of glucuronoyl esterase S213A mutant from Sporotrichum thermophile determined at 1.9 A resolution [Thermothelomyces thermophilus ATCC 42464],4G4J_A Crystal structure of glucuronoyl esterase S213A mutant from Sporotrichum thermophile in complex with methyl 4-O-methyl-beta-D-glucopyranuronate determined at 2.35 A resolution [Thermothelomyces thermophilus ATCC 42464]
6RU2_A	7.27e-55	14	307	74	374	CrystalStructure of Glucuronoyl Esterase from Cerrena unicolor [Cerrena unicolor],6RU2_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor [Cerrena unicolor]
6RTV_A	1.93e-54	14	307	80	380	CrystalStructure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant [Cerrena unicolor],6RTV_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant [Cerrena unicolor],6RU1_A Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid Um4X [Cerrena unicolor],6RU1_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid Um4X [Cerrena unicolor],6RV7_A Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid UXXR [Cerrena unicolor],6RV7_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid UXXR [Cerrena unicolor],6RV9_A Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid XUXXR [Cerrena unicolor],6RV9_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid XUXXR [Cerrena unicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7S1X0	1.88e-60	6	307	87	388	4-O-methyl-glucuronoyl methylesterase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=Cip2 PE=1 SV=2
G2QJR6	4.03e-60	2	306	85	391	4-O-methyl-glucuronoyl methylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=ge2 PE=1 SV=1
G0RV93	1.41e-58	6	307	155	454	4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=cip2 PE=1 SV=1
P0CT88	3.41e-57	14	307	98	399	4-O-methyl-glucuronoyl methylesterase 2 OS=Phanerochaete chrysosporium (strain RP-78 / ATCC MYA-4764 / FGSC 9002) OX=273507 GN=e_gw1.11.1537.1 PE=1 SV=1
A0A0A7EQR3	1.91e-53	14	307	168	468	4-O-methyl-glucuronoyl methylesterase OS=Cerrena unicolor OX=90312 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001807_01528.