CAZyme Information: MGYG000001807_01773

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001807_01773
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
307		36021.3	10.1264

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001807	2264331	MAG	Denmark	Europe

• Gene Location: Start: 157; End: 1080 Strand: -

Full Sequence      

MKYTFRLCAFVALLILFLPVSAQRRNSRYNEYIRQYSSLAVDQMNRYKIPASITLAQGLL
ESGAGQSVLARKSNNHFGIKCHNTWRGRKVYHDDDARDECFRAYRKVEESYEDHSKFLTQ
GARYAFLFKLKITDYKGWARGLKKAGYATDPSYANRLITIIEDYDLYKYDTKGMSKREAR
RWAKELKKKPWLANPHQVYIANGLAYVVARDGDTFRLLGGEFDISWKKLVDYNDLHKEYT
IEAGDIIYLKKKNKKAQKPYTVHIVRDGESMHSISQKYGIRLKNLYKMNRKDADEYVPEV
GDRLRLR

Enzyme Prediction     

No EC number prediction in MGYG000001807_01773.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	39	166	1.7e-36	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.88e-38	9	171	12	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	7.41e-38	44	170	175	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
smart00047	LYZ2	2.50e-29	31	170	10	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
TIGR02541	flagell_FlgJ	1.07e-27	31	161	150	290	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.
pfam01832	Glucosaminidase	4.82e-25	39	166	3	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT47310.1	1.87e-183	1	307	1	306
QRQ47886.1	2.65e-183	1	307	1	306
QMI81840.1	2.75e-183	1	307	1	307
QPH57455.1	2.26e-182	1	307	1	307
QBJ17132.1	5.30e-181	1	307	1	307

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	7.50e-14	49	161	21	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	9.04e-14	49	161	22	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	6.10e-13	49	161	22	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5DN4_A	5.53e-11	49	186	23	163	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN5_A	7.85e-11	49	162	23	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	3.49e-17	7	170	23	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	1.82e-14	49	160	180	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
P37710	9.68e-14	30	294	181	462	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q9KQ15	1.19e-12	49	168	181	313	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
P15931	1.42e-09	49	186	172	312	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000293	0.998995	0.000249	0.000150	0.000160	0.000149

TMHMM  Annotations     

start	end
5	22