CAZyme Information: MGYG000001808_00131

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA1375
• CAZyme ID: MGYG000001808_00131
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
833	MGYG000001808_12|CGC1	96451.35	5.4996

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001808	1306791	MAG	Denmark	Europe

• Gene Location: Start: 246; End: 2747 Strand: -

Full Sequence      

MDVEYYFNVIRCRYHLTDRNQFLIFGWFPKDNPDEYLVKVMLDNTALEQSVQIYNDMPAR
SFLRLIGANADQEYVIQAKLPEQLDSYRKMKIYTVSADGEKQHLCLDIPISKLIKERNQV
EYCVDEVSFDKETPVIRGWAVSGSPIEVSLKDEKGEDVPFDIAWKLRSDVISVYREIELS
DKCGFVITLKNNEDQRLSLCLSSDHFTTEEGFDLKQLRSDWIRRGRLSYRTIAALKRISD
HHYAKTVVKYIRENGWKRFIIRAAERLTGKGPGSIDYKEGRLQRLPTAQQLQAQREKVFS
YQPKFSIVVPLYKTPENYLLEMVRSVQNQTYSNWELCLSDGSGKDTPLRQVLTRLMEQDS
RIRAFFGDQPLKIAENTNVAIQNATGDYLVFMDHDDLLPEDALYECAAAINEVPEIDLLY
SDEDKISMDGKDYFQPHFKSDYNPDLLCSMNYINHLCVVKRSLQQKVGLLRGEYDGAQDY
DFVWRCCEQAKVIHHIPKVLYHWRGHMDSTAENPESKLYAFEAGKRAVQAHYDRMGLPAT
VEHGEYLGLYRTTYHWEEKPLVSIIIPNKDHIEDLDQCVQAILKKATYRNFEFIIIENNS
TEPETFAYYDKIQKEEPSVHVVYYKGDFNYSKINNFGVQYAKGSYYLLLNNDTELINPDF
MEEMLGYCMRPDVGIVGARLFYEDDTVQHAGVVVGIGGIAGHTFIGAGKNANGYFSRIIC
AQDYSAVTAACMMVKKEAFEKAGGLTEELKVAFNDIDFCLKVRRCGYLVVYNPYAELHHY
ESKSRGYEDTPEKVARFQSEIREFQKRWPEILEKGDPYYNINLTLNASDFSLR

Enzyme Prediction     

No EC number prediction in MGYG000001808_00131.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	306	413	1.5e-20	0.6235294117647059
GT2	563	741	1.9e-17	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	2.20e-95	303	504	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	8.14e-39	564	781	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	3.99e-29	560	786	3	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	2.55e-19	306	510	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	1.57e-18	306	412	1	105	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOV20089.1	0.0	7	833	6	812
CBL21587.1	1.49e-297	7	833	6	813
CBL24563.1	5.82e-297	7	833	6	812
QCU01344.1	4.88e-296	7	833	6	813
QHB25117.1	8.17e-292	7	833	5	813

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	5.59e-141	303	832	366	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	3.42e-89	272	833	288	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q57022	1.61e-10	303	403	4	102	Uncharacterized glycosyltransferase HI_0868 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0868 PE=3 SV=1
A0A0H2UR96	2.32e-08	306	403	6	101	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
Q58457	5.05e-08	303	486	8	194	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001808_00131.