CAZyme Information: MGYG000001809_01354

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella
• CAZyme ID: MGYG000001809_01354
• CAZy Family: CE15
• CAZyme Description: Carbohydrate esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349	MGYG000001809_18|CGC1	38827.88	4.8613

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001809	3938122	MAG	Denmark	Europe

• Gene Location: Start: 18598; End: 19647 Strand: +

Full Sequence      

MNSELLTQLPEPYGFERPELLNLLLSEEYGFLPELPVAVTADVESEDKNFCAGKAVLKKL
KLNCNTGNGTFSFPVSMMYPAGAGMREKEGKPVPCFLYISFTDRIPDLSFPAEEILDNGF
AVLHFCYQDVTSDDGDFNNGLAGVIYPDGKRGKAQCGKVGLWAWAAGRVMDYACTVPEID
HDRIGVVGHSRLGKTALLAGALDERFYCTFSNDSGCSGAALARGTKGETVGKIYHNFPYW
FYEKYGTYAEREEAMPFDQHFLLAAIAPRRVYVASASQDCWADPEGEYLSCVAAGEYYRK
MGLKGFIHPDRDPVPGDCFGEGEIGYHLRAGTHYLSREDWGHFMEYMRK

Enzyme Prediction     

No EC number prediction in MGYG000001809_01354.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE15	16	349	5.4e-69	0.8996282527881041

CDD Domains     

MGYG000001809_01354 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE95892.1	1.20e-108	17	349	33	359
ALL53565.1	1.63e-80	16	349	33	357
QOV20253.1	3.27e-80	17	348	35	356
QNK58798.1	5.98e-72	17	349	31	369
QDT35753.1	1.69e-71	17	346	77	415

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GRW_A	5.64e-57	17	346	30	392	GlucuronoylEsterase from Opitutus terrae (Au derivative) [Opitutus terrae PB90-1],6GS0_A Native Glucuronoyl Esterase from Opitutus terrae [Opitutus terrae PB90-1]
6SYU_A	8.67e-57	17	346	48	410	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with xylobiose [Opitutus terrae],6T0I_A The wild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with the aldotetrauronic acid XUX [Opitutus terrae]
6SYR_A	1.26e-56	17	346	59	421	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1]
6SYV_A	2.40e-56	17	346	48	410	Theglucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1],6SZO_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-galacturonate [Opitutus terrae PB90-1],6T0E_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1],6T0E_B The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1]
7B7H_A	6.63e-56	17	346	48	410	ChainA, Putative acetyl xylan esterase [Opitutus terrae PB90-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0K2VM55	2.71e-53	113	346	189	422	Carbohydrate esterase MZ0003 OS=Unknown prokaryotic organism OX=2725 GN=MZ0003 PE=1 SV=1
G0RV93	1.97e-21	11	330	127	412	4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=cip2 PE=1 SV=1
D8QLP9	1.92e-18	9	303	36	325	4-O-methyl-glucuronoyl methylesterase OS=Schizophyllum commune (strain H4-8 / FGSC 9210) OX=578458 GN=SCHCODRAFT_238770 PE=1 SV=1
B2ABS0	1.01e-17	19	302	147	412	4-O-methyl-glucuronoyl methylesterase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=ge1 PE=1 SV=1
P0CU53	5.98e-17	8	303	44	339	4-O-methyl-glucuronoyl methylesterase 1 OS=Wolfiporia cocos (strain MD-104) OX=742152 GN=WOLCODRAFT_23632 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001809_01354.