CAZyme Information: MGYG000001809_02170

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella
• CAZyme ID: MGYG000001809_02170
• CAZy Family: GT51
• CAZyme Description: Monofunctional glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
249		28125.8	4.3314

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001809	3938122	MAG	Denmark	Europe

• Gene Location: Start: 29692; End: 30441 Strand: +

Full Sequence      

MRFLKKLILFTLLVLFAGAAMVGGRLVWQGYQIYKQVTAETPLSEKVAEIRANPHYTTLD
ELPQTYKDAVIAVEDSRFYKHGGFDLISTGRAVVINLREGELAEGGSTITQQLAKNMYFT
QEKKILRKVAELFVAFDLERDYTKDEILELYLNTIYFGSGYYCVYDAAEGYFGKEPSQMT
DYESTLLAGIPNAPSVYSLTNSPELAAQRQRTVLECMVDQDYITQEQADAILAEGEKEQN
EEIQQAGEE

Enzyme Prediction     

No EC number prediction in MGYG000001809_02170.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	49	218	4.7e-62	0.96045197740113

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	3.76e-79	41	218	3	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	1.40e-76	56	244	4	185	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.18e-74	1	247	9	270	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	3.56e-70	1	234	2	247	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	3.10e-54	1	229	1	241	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO38940.1	2.96e-87	1	232	1	232
QRP41835.1	3.07e-85	29	235	28	234
ASN93505.1	3.07e-85	29	235	28	234
QJU22158.1	6.18e-85	29	235	28	234
QIX92252.1	1.01e-83	29	235	28	234

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	1.62e-46	56	227	22	193	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	6.45e-46	56	227	22	193	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	2.87e-40	45	227	48	236	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	2.94e-40	45	227	12	200	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	3.02e-40	45	227	13	201	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38050	3.23e-45	53	228	66	241	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
Q9KNU5	2.00e-44	1	234	1	246	Penicillin-binding protein 1A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcA PE=3 SV=2
Q07259	2.72e-43	40	234	33	226	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
P39793	8.80e-42	4	227	33	269	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
O66874	2.60e-41	56	227	65	236	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997921	0.001343	0.000569	0.000009	0.000005	0.000178

TMHMM  Annotations     

start	end
7	29