CAZyme Information: MGYG000001810_00720

Basic Information

• Species: Mediterraneibacter sp002314255
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Mediterraneibacter; Mediterraneibacter sp002314255
• CAZyme ID: MGYG000001810_00720
• CAZy Family: GH101
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
2064	MGYG000001810_6|CGC2	224282.19	4.0547

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001810	2943094	MAG	Denmark	Europe

• Gene Location: Start: 60659; End: 66853 Strand: -

Full Sequence      

MKKRRLKLLCLFLTASMTAPTILQYVPGSMSLPYEVQAAGAEDAAENVQVSARDASDGID
DAWTQDPESVSGSGAVCAVEDGWLHLKSDPSNGNNPGTKPAIFVNPNTFDFSQEGFFDFT
LKSNNGNTGQNDSDRFGVYLGYNTDQNGMFVGYDNGGWFWQKYTGGSGDWYQGSRHAAPA
QGEEAAVHIEWTADHKMTLTLDGETVFENEDFSGIADVLGTQIAFKCGSWNQNTTDVLVK
DIHYTGQAEAAVYPVTGKVLDTQGSPIEGAKVTIGDTTVETDAEGTYTVELPDGTYTVTV
VKDGYMNGSGSITVSGQEASVGDITLDVEPDIETETLSTEDMDVYVSKTFPSVVKYEMKG
GLEGKTFYGQTEAINTVRINGVDIQVAPEDVKAEFDGTTATYVMTVKNEEKHIDAEITAE
LKAEANQLAFNITKIENKLQDQTTTNKYGDKVETYPLQTIGIPNHSLISVRSTQSGANLK
GAVMSSNTHKSGDELIQVNGDMGSYNNRDYMYAFLSTDEMSAGMWSNSEHEGRTVAAPVY
GGSQNTRIYATSEERDGYKTMGLASAEWYYHRNVTDSKGVQYTVTETEMPQSKIVIAGDM
NEDAQVNWQDGAIAFRDIMNNPYKSEEVPELVAWRIAMNFGGQAQNPFLTTLDNVKRVAQ
HTDGLGQSILLKGYASEGHDSGHPDYDNIGERMGGAEDMNTLMEKGAEYGARFGIHVNAS
EMYPEAKAFSEELVRRNSAGALSYGWNWLDQGIGIDGIYDLASGERQARFDALKEKVGDN
MDFVYVDVWGNLTSGNSEDSWETRKLSDMITDNGWRMTTEWGSGNEYDSTFQHWACDLTY
GGYTSKGENSEVMRFLRNHQKDSWVGDYPSYGGVANAPLLGGYNMKDFEGWQGRNDYDAY
ITNLYTHDLMTKFLQHYQVVKWEDGDPVQMTDNGETYTWTPEKEITLKADPKKSSAETDT
VVVTRGSTDPSDAAYRDRTVTLNGIVISQGSVTQGDNTNAKGTESYLIPWNWDSETGDQV
ASEEEKLYHWNTQGGETTWELQDSWKNLTDVKVYKLTDLGKTEEQTIPVVDGTITLTAEA
ETPYVVCKGDEANLEITWSEGMHIVDAGFNSGNDGLNEYWEKSGEGTAEIAKSQYSNPML
KMDGEVSMTQELTDLKAGEEYAVYVGVDNRSEAKASMTVKADGTVLDSNYTEESIAKNYV
KAYTHSNSSATVDGSSYFQNMYVFFTAPESGTVTLTLSREAGDGSTYFDDIRVVESEMDV
VKKDEDGNVVGMEQDFENNAQGIYPFVIGGIEGVEDNRTHLSELHEPYTQAGWDVKKMDD
VLDGNWSIKTNGLVQRNALVYQTIPQNFRFEPGRTYKVSFDYQAGSDGTYGVTIGDGEFE
GGTSLETLDMAMGADQDGHYETTIVGSASGQTWFGIYSTGTAPDLQGTSGSAANFGGYQD
FVLDNLKIELVDEEVTADALQALIEEAETGYDKTEYLDADWAVFQSALTDAKVALNKDKQ
DQKQIEDAYYALKAAMMTLDTASGTEADDKYDIASDKYTVEAGSAQPQSGNEGPVEFAQD
GNGSTHWHTSWSADVVEADGSGDGWYQFNFSEPMTVNGMRYLPRSGAANANGKIIKADIL
VSSDNGASWETAVKDAEFSTTTMWQKVSFDAVEGVTNVRIVATETAGQSAAEANKYVSAA
ELRVLQPVEDQTETADKSALEAAVSGAEGLNSGDYTEESWKTVEEKLAEAKAVLEKEDAT
AYDIALALANLNDAVADLEKSENPQPGEEISTAVLEYAIELAGGVNTDGVIETVKENFEN
ALQNAQDILAKVQSGDASVTQNQVDNAWRNLIKAMQYMEFKEANKDDLAKVIALAEEMNG
KLDKYLDEGKAAFTTALTEAKEVYENEIATQEEVTSAWQNLLDAMANMMLKPDKGLLEDL
IAQAEGLNEADYEAQSFAVMRTALAAAKEVFDNVDADQEEIDASASALKDAIAKLTPAAG
TDQSGNGGQSDSTGGSKTEGQTAASADKNSSTASAGKTSSTQNSGSAAKATKTGDTANAL
PFAAAAAAAFAAGAAVLLKKKEEN

Enzyme Prediction     

EC	3.2.1.97

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH101	340	1088	0	0.9957567185289957
CBM32	1544	1682	6.2e-16	0.9354838709677419

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam12905	Glyco_hydro_101	1.65e-166	609	901	1	273	Endo-alpha-N-acetylgalactosaminidase. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by the S. pneumoniae protein Endo-alpha-N-acetylgalactosaminidase, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor.
cd14244	GH_101_like	5.21e-140	622	924	1	298	Endo-a-N-acetylgalactosaminidase and related glcyosyl hydrolases. This family contains the enzymatically active domain of cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins (EC:3.2.1.97). It has been classified as glycosyl hydrolase family 101 in the Cazy resource. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae and other commensal human bacteria is largely determined by their ability to degrade host glycoproteins and to metabolize the resultant carbohydrates.
pfam17974	GalBD_like	3.60e-112	1249	1437	1	190	Galactose-binding domain-like. Proteins containing a galactose-binding domain-like fold can be found in several different protein families, in both eukaryotes and prokaryotes. The common function of these domains is to bind to specific ligands, such as cell-surface-attached carbohydrate substrates for galactose oxidase and sialidase, phospholipids on the outer side of the mammalian cell membrane for coagulation factor Va, membrane-anchored ephrin for the Eph family of receptor tyrosine kinases, and a complex of broken single-stranded DNA and DNA polymerase beta for XRCC1. The structure of the galactose-binding domain-like members consists of a beta-sandwich, in which the strands making up the sheets exhibit a jellyroll fold.
pfam18080	Gal_mutarotas_3	3.06e-87	337	608	1	243	Galactose mutarotase-like fold domain. This domain is found in endo-alpha-N-acetylgalactosaminidase present in Streptococcus pneumoniae. Endo-alpha-N-acetylgalactosaminidase is a cell surface-anchored glycoside hydrolase involved in the breakdown of mucin type O-linked glycans. The domain, known as domain 2, exhibits strong structural similarlity to the galactose mutarotase-like fold but lacks the active site residues. Domains, found in a number of glycoside hydrolases, structurally similar to domain 2 confer stability to the multidomain architectures.
pfam17451	Glyco_hyd_101C	2.61e-36	907	1062	1	111	Glycosyl hydrolase 101 beta sandwich domain. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by a S. pneumoniae protein, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor. This domain represents C-terminal the beta sandwich domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK63058.1	0.0	2	1919	4	1888
BBK23316.1	0.0	2	1913	4	1882
QOL33684.1	0.0	63	1978	81	1983
ALO71818.1	0.0	61	1909	68	1921
VEG78580.1	0.0	61	1912	68	1924

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6QEV_B	0.0	332	1514	7	1182	EngBFDARPin Fusion 4b B6 [Bifidobacterium longum]
5A58_A	0.0	335	1449	17	1101	Thestructure of GH101 D764N mutant from Streptococcus pneumoniae TIGR4 in complex with serinyl T-antigen [Streptococcus pneumoniae TIGR4]
5A59_A	0.0	335	1449	17	1101	Thestructure of GH101 E796Q mutant from Streptococcus pneumoniae TIGR4 in complex with T-antigen [Streptococcus pneumoniae TIGR4],5A5A_A The structure of GH101 E796Q mutant from Streptococcus pneumoniae TIGR4 in complex with PNP-T-antigen [Streptococcus pneumoniae TIGR4]
6QEP_A	0.0	332	1514	7	1182	EngBFDARPin Fusion 4b H14 [Bifidobacterium longum]
6QFO_A	0.0	332	1514	7	1182	EngBFDARPin Fusion 9b 3G124 [Bifidobacterium longum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2MGH6	0.0	88	1718	151	1657	Endo-alpha-N-acetylgalactosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0368 PE=1 SV=1
Q8DR60	0.0	88	1718	151	1657	Endo-alpha-N-acetylgalactosaminidase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=spr0328 PE=1 SV=1
A9WNA0	1.03e-138	336	1449	51	1035	Putative endo-alpha-N-acetylgalactosaminidase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) OX=288705 GN=RSal33209_1326 PE=3 SV=2
E8MGH9	2.84e-11	1644	1903	1618	1869	Beta-L-arabinobiosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA2 PE=1 SV=1
Q0TR53	2.64e-06	1544	1702	634	783	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.264368	0.678614	0.054919	0.001308	0.000447	0.000319

TMHMM  Annotations     

start	end
2036	2058