CAZyme Information: MGYG000001810_01243

Basic Information

• Species: Mediterraneibacter sp002314255
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Mediterraneibacter; Mediterraneibacter sp002314255
• CAZyme ID: MGYG000001810_01243
• CAZy Family: GH94
• CAZyme Description: Cellobiose phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
899	MGYG000001810_13|CGC1	101026.29	5.2741

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001810	2943094	MAG	Denmark	Europe

• Gene Location: Start: 15988; End: 18687 Strand: +

Full Sequence      

MKHLQFTDEHGSFSIEQPENTSYLYFPLASEKGLKSSVTPNLGGDAKIDQETFLLEPVSA
ENLHNNRSVRNFWLVSDTGEVFSASGASAEQEAARFTKLQDDSRITAGFMWHSMERISKS
QAVRTVVTSFIPVRDNAEIMYITVRNLSDSAKVLIPFAAVPVYGRSADNIRDHRNVTSML
HRIRTESHGVLVRPTMSFDERGHRPNSMIYYVYGCSGAGEAPESFFPTVEEFLGEGGTYT
HPRAVCERRTGVPSGSFAAGREAMGAFRFPEVHLAPGEEADYILILGAEDNRESISQIYE
KYNTPDKVKKALDETKSWWREKVNTGFHTGDADFDRLMKWICFQPFLRRLFGCSFLPHHD
YGRGGRGWRDLWQDCLSLLLMDPDGVGQMIEKNFGGVRIDGTNATIIGEGDGNFIADRNG
IARVWMDHALWPQMTTKLYIDQTGDVEILNRKVPYFKDAQTCRGTQNDEQWDAGQGSLLR
TKDGEIYTGSILEHLLIQQLTAFYEVGNHNIYRLRGADWNDALDMASEHGESVAFTCAYA
GNLRDLASMIRLLESRSGEKEAVLAGELQILLNGDAGLFEDPDAKNVLLADYTRSCRHQI
SGGHFSISLSVLADDLERRADWLTGYLREQEWIDGGADEGWFNSYYDNHGRAVEGFFPNE
VRMMLTGQVFSIMGNVASDEQIRRITASADHYLYRKEIGGYRLNTDFHELKFDMGRMFGF
AYGEKENGAVFSHMTVMYANALYRRGFAKEGWKALKTLAETALDFDTSRIYPGIPEYFRS
DGRGMYHYLTGAASWFMLTMITQVFGVRGEAGDLIFAPRLMGEQFDSQGKASVSLVFAGK
QLEVIYENPEHKDSGEYTISSAACEGYRLQTDSAGYAVLPRKVLDGFSGDHLRVTVTLN

Enzyme Prediction     

EC	2.4.1.31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH94	71	866	4.2e-159	0.6611969111969112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11749	GH94N_LBP_like	6.02e-121	72	298	1	229	N-terminal-like domain of Paenibacillus sp. YM-1 Laminaribiose Phosphorylase and similar proteins. The glycoside hydrolase family 94 (previously known as glycosyltransferase family 36) includes bacterial laminaribiose phosphorylase. This N-terminal domain is involved in oligomerization and may play a role in catalysis, but it is separate from the catalytic domain [an (alpha/alpha)(6) barrel]. Bacterial laminaribiose phosphorylase phosphorolyzes laminaribiose into alpha-glucose 1-phosphate and glucose, but does not phosphorolyze other glucobioses; it slightly phosphorolyzed laminaritriose and higher laminarioligosaccharides. The GH64N domain, as represented by this model, is also found at the N-terminus of GH94 members with uncharacterized specificities.
COG3459	COG3459	1.80e-44	70	851	331	1022	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
pfam17167	Glyco_hydro_36	1.28e-20	318	808	1	425	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.
cd11751	GH94N_like_4	4.04e-14	77	293	18	222	Glycoside hydrolase family 94 N-terminal-like domain of uncharacterized function. The glycoside hydrolase family 94 (previously known as glycosyltransferase family 36) includes cellobiose phosphorylase (EC:2.4.1.20), cellodextrin phosphorylase (EC:2.4.1.49), chitobiose phosphorylase (EC:2.4.1.-), amongst other members. Their N-terminal domain is involved in oligomerization and may play a role in catalysis, but it is separate from the catalytic domain [an (alpha/alpha)(6) barrel]. The GH64N domain, as represented by this model, is found near the N-terminus of GH94 members and related proteins with uncharacterized specificities.
pfam06165	Glyco_transf_36	1.48e-13	77	287	57	247	Glycosyltransferase family 36. The glycosyltransferase family 36 includes cellobiose phosphorylase (EC:2.4.1.20), cellodextrin phosphorylase (EC:2.4.1.49), chitobiose phosphorylase (EC:2.4.1.-). Many members of this family contain two copies of this domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGX44464.1	0.0	1	898	1	898
VTS90962.1	0.0	1	898	1	898
VED93131.1	0.0	1	898	1	898
QGX45995.1	0.0	1	898	1	898
QMS96220.1	0.0	1	898	1	898

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GGY_A	5.33e-303	5	890	9	899	Paenibacillussp. YM1 laminaribiose phosphorylase with sulphate bound [Paenibacillus sp. YM1],6GGY_B Paenibacillus sp. YM1 laminaribiose phosphorylase with sulphate bound [Paenibacillus sp. YM1],6GH2_A Paenibacillus sp. YM1 laminaribiose phosphorylase with alpha-glc-1-phosphate bound [Paenibacillus sp. YM1],6GH2_B Paenibacillus sp. YM1 laminaribiose phosphorylase with alpha-glc-1-phosphate bound [Paenibacillus sp. YM1],6GH3_A Paenibacillus sp. YM1 laminaribiose phosphorylase with alpha-man-1-phosphate bound [Paenibacillus sp. YM1],6GH3_B Paenibacillus sp. YM1 laminaribiose phosphorylase with alpha-man-1-phosphate bound [Paenibacillus sp. YM1]
3RRS_A	3.44e-24	1	878	1	816	Crystalstructure analysis of cellobiose phosphorylase from Cellulomonas uda [Cellulomonas uda],3RRS_B Crystal structure analysis of cellobiose phosphorylase from Cellulomonas uda [Cellulomonas uda],3RSY_A Cellobiose phosphorylase from Cellulomonas uda in complex with sulfate and glycerol [Cellulomonas uda],3RSY_B Cellobiose phosphorylase from Cellulomonas uda in complex with sulfate and glycerol [Cellulomonas uda],3S4A_A Cellobiose phosphorylase from Cellulomonas uda in complex with cellobiose [Cellulomonas uda],3S4A_B Cellobiose phosphorylase from Cellulomonas uda in complex with cellobiose [Cellulomonas uda],3S4B_A Cellobiose phosphorylase from Cellulomonas uda in complex with glucose [Cellulomonas uda],3S4B_B Cellobiose phosphorylase from Cellulomonas uda in complex with glucose [Cellulomonas uda]
3S4C_A	1.37e-23	1	878	1	816	Lactosephosphorylase in complex with sulfate [Cellulomonas uda],3S4D_A Lactose phosphorylase in a ternary complex with cellobiose and sulfate [Cellulomonas uda]
3QDE_A	9.32e-23	119	855	109	779	ChainA, Cellobiose phosphorylase [Acetivibrio thermocellus],3QDE_B Chain B, Cellobiose phosphorylase [Acetivibrio thermocellus]
4ZLE_A	2.33e-10	221	875	212	775	Cellobionicacid phosphorylase - ligand free structure [Saccharophagus degradans 2-40],4ZLF_A Cellobionic acid phosphorylase - cellobionic acid complex [Saccharophagus degradans 2-40],4ZLG_A Cellobionic acid phosphorylase - gluconic acid complex [Saccharophagus degradans 2-40],4ZLI_A Cellobionic acid phosphorylase - 3-O-beta-D-glucopyranosyl-alpha-D-glucopyranuronic acid complex [Saccharophagus degradans 2-40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B9K7M6	3.88e-22	1	875	1	803	Cellobiose phosphorylase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=cbpA PE=1 SV=1
Q7S0S2	4.53e-13	222	820	220	731	Cellobionic acid phosphorylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU09425 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001810_01243.