CAZyme Information: MGYG000001810_01361

Basic Information

• Species: Mediterraneibacter sp002314255
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Mediterraneibacter; Mediterraneibacter sp002314255
• CAZyme ID: MGYG000001810_01361
• CAZy Family: GH97
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1559		169581.9	3.9752

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001810	2943094	MAG	Denmark	Europe

• Gene Location: Start: 7591; End: 12270 Strand: +

Full Sequence      

MEKKEKRTCCKNLWIRRSLKTALALVLSSQMLFGNAVSVLAADPASTGESAEAESKVVLD
SAWEVENPTEGNLTVNEDGSITIRTEGGTIDSSMNNVLYYQLPNSTDYDFTVKVSGEFTA
NYQGAHLMIASGKNLENAVGVVRRYHGYLGGNYGTNLLMGVMQDGNPSEYYEAAGDIGNE
FYLKLQKQNGRITGFYAEEYSDNDSDWNQIIDPTKGDVGYVDKGSALIDPENIYLAIAAA
NGGGNTPTEITFSDLRVGGIPVAFTADPSALNSVTLSGEKEMEVDAKQQLILTGMDYEGN
EITEFDSVTYTSSDEDVAVVDENGVVTGLANGNAVITAEAVLGGVTKTASLSIQVGDIVA
EETWKLASPDGSTEMTVELLTGGTLQYRAEQNGVENIGSSPLGLVTSVGDFSKGLVFKEA
SAVKEINDSYTMISGKSDVYTDHCNEQTLTFTLKNDDSVEFDLIMRVYDDGTAYRYAVRT
EKEGTEIRISDETSGLQLPEGADVYWMDYSSSTWNYEGQYQTTTTEGLEVNATPSIPFLY
GKDGVWTLFSEADLNGTYCGSMFTVGEGGLLDVSFCKTQGTTPVVTTTPFKSPWRAAITG
GPEDIVENTMIENLSTPADYETYDYESWVEPGLSSWSWVANWGSGISDQSKAETHLNWIE
FGGEIGWKYYILDEGWNEGGRGNYSGMRDWWPEVKACAEENGVKLWVWVHVSDIDTQEER
DRLFKEWSEEGIVGVKPDFFDGEDQAHMQLYDDLYKDAAKYHLMLLVHGANKPTGEIRTY
PNVYGREAIRGQESGGISAEQYTLIPFIRAAIGPAEVTEEIRSKDYSKTTMGFQIALTAL
IEDGIHSMGSAPDVYRSIPEAMSYYTDYPDGWDDTEFVNGEVGEYLSIARKAGNSWYVSG
ISVDPRQMEAALDFLDEDTEYTALLYKENGRQDIDMEIITGVTSETVLNIDVLYGGGYAL
HILPKDEVDGVKSITAQPSEVTVEEGHYSDPVELTLAPEDAKFQDVVWSSADENIATVDQ
NGVIRGVTAGMTTVTVRSAFDENVKAEIKVTVDPARYVLDEEMWTILNKNDNVLINNTDS
ATITTEHGVLGENNWNNMFAMDVPDGSSDFTITAKISGGLNADYQGGFITVFDKENPDDL
SVAAGRRHHSYLMGSHPQSLGVMTNGGSIGEFYCADENYDSDVYLKIAKEGNIFICSYSY
DGETWTEITNKGTEVTVTNDRLAASANLCVGFYAGSGGGSTPIDVTISEFTFNGEKIPVA
VDTQAEQEEISTAVLEYALDLAEEADTDGVAASVVKIFNEARAEAQDILTRVQSGDRTVT
QEMVDQSWMNLIKAMQYLSFKQGDKTDLQKVIDLAYTIDLTEYLEEGQQAFADALAASEA
VLADGDAMQDEVDQAWRDLLKAMSELRLKPNKDALEALINEANGLSTENADEETAAAFRS
ALAMAVNVYENEQATEDEVTAAYEQLHAAVGRLVAAADGSTGANADTGSSGEKGEGGQSQ
DTQNGEKTALSSGKTSETSAAGKAYVSVKTGDQTEIWILIGAMMAALTGGALVIRRRRG

Enzyme Prediction     

No EC number prediction in MGYG000001810_01361.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	361	962	2.3e-138	0.9809825673534073

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14508	GH97_N	6.31e-47	368	617	1	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam10566	Glyco_hydro_97	1.99e-44	627	869	3	278	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14509	GH97_C	7.31e-23	872	962	1	96	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.
pfam02368	Big_2	5.35e-10	972	1050	1	77	Bacterial Ig-like domain (group 2). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in bacterial and phage surface proteins such as intimins.
pfam07081	DUF1349	2.18e-07	1107	1253	37	167	Protein of unknown function (DUF1349). This family consists of several hypothetical bacterial proteins but contains one sequence from Saccharomyces cerevisiae. Members of this family are typically around 200 residues in length. The function of this family is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWI66989.1	4.33e-109	672	966	1	301
ADO69318.1	4.50e-97	364	962	26	591
AUO18240.1	3.58e-96	353	997	19	640
ATB36826.1	8.41e-95	364	962	25	589
AEE97714.1	5.24e-91	361	964	9	592

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XFM_A	8.88e-59	369	942	22	638	Crystalstructure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_B Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_C Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_D Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron]
3A24_A	5.94e-47	368	962	6	640	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
5E1Q_A	5.62e-46	368	962	20	654	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
3WFA_A	2.63e-34	365	974	4	718	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]
2JKA_A	2.65e-34	365	974	13	727	Nativestructure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKA_B Native structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKE_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKE_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKP_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482],2JKP_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D7CFN7	1.09e-60	361	900	32	561	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1
Q8A6L0	7.18e-48	360	962	19	661	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
G8JZS4	6.64e-34	359	974	18	738	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1
E8MGH9	6.43e-06	1201	1466	1614	1868	Beta-L-arabinobiosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000629	0.998487	0.000233	0.000263	0.000189	0.000156

TMHMM  Annotations     

start	end
1536	1554