CAZyme Information: MGYG000001810_01947

Basic Information

• Species: Mediterraneibacter sp002314255
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Mediterraneibacter; Mediterraneibacter sp002314255
• CAZyme ID: MGYG000001810_01947
• CAZy Family: GH136
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1549	MGYG000001810_26|CGC1	166239.07	3.9467

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001810	2943094	MAG	Denmark	Europe

• Gene Location: Start: 8185; End: 12834 Strand: -

Full Sequence      

MKKKVLSGLLALALVVTSGASMIPAYTAEAEELGTTYYVSSIDGDDSNDGLSEDKAFATL
DKINEITLQPGDEVLLEKGSVFEDQALHIKGSGSEEAPIIVSTYGEGDRPQINTNGHGQW
YQNYGGHLDNTNHKWKGTVSSSILLMDVEYIEISGLEITNDRASATDTEKDKEYNDAFAM
DRTGVAGVAKDKGTVDHIVLDDLYIHDVTGNVYNKHMANGGIYFIVETPENESETGVARY
NDVQIRNCYLDTVNRWGIAVGYTYQWGQFKTAALSDDTMEKYGSSNVVIENNYVANSGGD
AITTMYLDRPVVQYNVSQNAAKQINTTDYSKQQPQLDPTTGEWTGNYLAVGNQRVAAGIW
PWKCKDAVFQYNECFNTMNASNGNGDGQPWDADYGDGTNYQYNYSHGNTASTVMFCGVES
INNTFRYNISQNEDMGPLDPAGNTGNCHVYNNTFYIKEGLTSIWSTMHSNNGPMTIENNI
FYFAGDTPVAATNWNPSGNKVYDNNLYYNVSTYPNDENAVKVDAGTPVLVDAGSGPVQAA
EDGKARLHDDPNEETVFDGYKLAENSPALNAGKVITDQNGFELEHDFFGHELTAVPEIGA
AESDLVSLAVRSNVYRVNASALEISALPKNTTAAELKENLIYDSAVTLIVTDSEGNELDD
ADIVAGGMKVVLTYGEDSLTYTIVENTDNELKSSVFMVSDKTIYVPSTENNPATVEELKD
GVEVHETASVSVWNGEEEVADGAVAEGMTLRITAENGTANDYTIAVKNDYQWAKDYVHGQ
QGNVWFAQAKIDGEWQNMTEVDSSGWPNWQLDTYYGPGVDAPQGTTSGYGDDVHGLISTP
IKTTTAEATAMAFRAPKTGMVNFSIKDDEPYLRQAGNSGGSVIITLLVNGEEVQSCKLTD
SNVKGDFPDVNNIWVEKGDWILVQASNEGQPSKGSVHITPEITYVDAEYSEENPLVFPST
PDETVSFEAEYATELINSNDGDSDPNWPLTVASAEWASGGRFVNCLAYKDYIKYAYRADV
AGTYEVTMTYRSGSSANKVQLMSEPEGVIVSEIQTVKNANQQTDTLTFNITVTQAGAGTL
VVTAPDSGKGPQIDKFDIKLVETAPEVDKSELQAAYDEAVQMDLSIYTDESKAVMEDAIA
AAAEVLADENADQDAVDEALAALNSAKDQLVVKSADKSALEEVLAAAEEYAAKISNYTPE
TAEVFQTAYDAAKEVFADAAASQEEVDNAAAALQSAIDGLKLAGEISTAVLEYALELSET
VDTEGVIESVVNIFNERKAAAQDILARVQAGDQSVTQAMVDQSWADLIEIMQYMSFKSGD
MTDLQKVVDYAKTLDLSKYLDDGQQAFKDALAAGEAVLAEEFAEQDEIDQAWKALLKAMS
ELRLKPSKDALEALIADANELNTEGASEEAVAAFNSALTRALCVLEDDQATEEEVTAAEA
GLKAAIDQLTASTGSADETPSEPSAPDSSAGGNTGSSDNGSADSGSGQQIAAADKTSSQN
SGNSGNKTTAAASGSKAVKTGDSVLPIAGSAAAMMLAAAAAVLAKRKRS

Enzyme Prediction     

EC	3.2.1.140

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH136	34	602	2.3e-158	0.9959266802443992

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033804	Streccoc_I_II	6.71e-05	1102	1446	66	428	antigen I/II family LPXTG-anchored adhesin. Members of the antigen I/II family are adhesins with a glucan-binding domain, two types of repetitive regions, an isopeptide bond-forming domain associated with shear resistance, and a C-terminal LPXTG motif for anchoring to the cell wall. They occur in oral Streptococci, and tend to be major cell surface adhesins. Members of this family include SspA and SspB from Streptococcus gordonii, antigen I/II from S. mutans, etc.
PRK05431	PRK05431	1.48e-04	1334	1422	2	100	seryl-tRNA synthetase; Provisional
cd02795	CBM6-CBM35-CBM36_like	3.17e-04	990	1098	15	124	Carbohydrate Binding Module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules. This alignment model also contains the C-terminal domains of bacterial insecticidal toxins, where they may be involved in determining insect specificity through carbohydrate binding functionality.
pfam07554	FIVAR	0.004	1178	1240	1	68	FIVAR domain. This domain is found in a wide variety of contexts, but mostly occurring in cell wall associated proteins. A lack of conserved catalytic residues suggests that it is a binding domain. From context, possible substrates are hyaluronate or fibronectin (personal obs: C Yeats). This is further evidenced by. Possibly the exact substrate is N-acetyl glucosamine. Finding it in the same protein as pfam05089 further supports this proposal. It is found in the C-terminal part of Bacillus sp. Gellan lyase, which is removed during maturation. Some of the proteins it is found in are involved in methicillin resistance. The name FIVAR derives from Found In Various Architectures.
PRK03598	PRK03598	0.005	1153	1245	80	173	putative efflux pump membrane fusion protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSY56996.1	4.41e-190	34	973	45	960
QTB91395.1	4.41e-190	34	973	45	960
ADP35567.1	5.58e-190	11	954	45	934
VEG19581.1	1.60e-185	27	1099	26	1024
BAQ97658.1	1.60e-185	27	1099	26	1024

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7V6M_A	4.41e-318	34	603	8	577	ChainA, Fibronectin type III domain-containing protein [Tyzzerella nexilis]
7V6I_A	2.51e-160	34	603	13	609	ChainA, Lacto-N-biosidase [Bifidobacterium saguini DSM 23967]
5GQC_A	1.64e-159	27	605	10	599	Crystalstructure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_B Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_C Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_D Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_E Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_F Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_G Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_H Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQF_A Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, lacto-N-biose complex [Bifidobacterium longum subsp. longum],5GQF_B Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, lacto-N-biose complex [Bifidobacterium longum subsp. longum],5GQG_A Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, galacto-N-biose complex [Bifidobacterium longum subsp. longum],5GQG_B Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, galacto-N-biose complex [Bifidobacterium longum subsp. longum]
6KQT_A	8.11e-120	34	479	244	660	CrystalStructure of GH136 lacto-N-biosidase from Eubacterium ramulus - native protein [Eubacterium ramulus ATCC 29099]
6KQS_A	8.99e-116	34	479	244	660	CrystalStructure of GH136 lacto-N-biosidase from Eubacterium ramulus - selenomethionine derivative [Eubacterium ramulus ATCC 29099]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002373	0.990488	0.005642	0.000856	0.000345	0.000264

TMHMM  Annotations     

start	end
5	27
1524	1543