CAZyme Information: MGYG000001811_00001

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA11774
• CAZyme ID: MGYG000001811_00001
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
226		25349.89	8.901

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001811	2039620	MAG	Denmark	Europe

• Gene Location: Start: 661; End: 1341 Strand: +

Full Sequence      

MNYGKNRTSRKQKELNSKSTMARKRFTVIFCKALLFCFLAAIVIGIFVAIGFARKIIKSA
PDINDIDATPTGYLSTVLDSDGNEIATLVASGSNRVYVTIDEIPLDLQHAFVAIEDERFY
DHNGIDMKGIVRAGFKGITSGHFSEGASTITQQLLKNNVFTDWTSESTFSDRVERKIQEQ
YLAVQLEKKVDKDWIMENYLNSINLGQNTLGVQAASLRYFNKPSRS

Enzyme Prediction     

No EC number prediction in MGYG000001811_00001.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	81	224	1.8e-47	0.7570621468926554

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	1.03e-61	81	223	1	134	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	3.32e-58	20	223	1	198	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	8.23e-53	94	223	1	123	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	8.97e-50	32	223	3	188	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	3.50e-37	30	223	3	187	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN95629.1	3.56e-102	1	222	1	223
CBL12211.1	2.34e-99	1	222	1	223
VCV20745.1	2.34e-99	1	222	1	223
CBL09910.1	2.34e-99	1	222	1	223
CBK73222.1	5.16e-86	1	223	1	224

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	4.13e-27	95	222	20	140	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	1.15e-26	95	222	20	140	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5U2G_A	1.56e-24	95	222	40	160	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
4OON_A	3.29e-23	95	223	39	160	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
7U4H_A	8.52e-23	58	222	3	158	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0PZT1	8.24e-36	49	221	45	218	Penicillin-binding protein 1A OS=Clostridium novyi (strain NT) OX=386415 GN=pbpA PE=3 SV=1
Q891X1	3.77e-33	32	222	15	204	Penicillin-binding protein 1A OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=pbpA PE=3 SV=1
Q97GR5	1.79e-32	23	225	30	225	Penicillin-binding protein 1A OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=pbpA PE=3 SV=1
Q0SRL7	1.80e-32	10	222	11	215	Penicillin-binding protein 1A OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=pbpA PE=3 SV=1
Q0TNZ8	2.46e-32	10	222	11	215	Penicillin-binding protein 1A OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999986	0.000044	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
28	50