CAZyme Information: MGYG000001811_00272

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA11774
• CAZyme ID: MGYG000001811_00272
• CAZy Family: GT2
• CAZyme Description: N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
252	MGYG000001811_24|CGC1	29486.9	6.8314

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001811	2039620	MAG	Denmark	Europe

• Gene Location: Start: 3734; End: 4492 Strand: -

Full Sequence      

MIDLSIAIVAYNDEEDVRDAVCSILEHTAKTISKKIYIIDNSDRENRLRELTEQEPEVVY
LKTKENKGFGAGHNEVLGKLDSKYHAIVNPDILLVEDSFRKLLEFMEDSTIGMAVPRIVD
EDGSMQESYRKEPTVLDMVIRSTNLMKKRQREHALADKDFSKAFQVPFAHGCFYLIRTEL
FEKLGGFDERYFLYMEDADLCKQVNQCSRLVYCPDTKVIHKWDRGSKKRADLKKIHIQSM
ISYFKKWGWKLW

Enzyme Prediction     

No EC number prediction in MGYG000001811_00272.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	5	185	2.8e-17	0.9941176470588236

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	3.43e-43	6	221	1	165	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	6.96e-37	1	247	2	247	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	1.36e-13	5	181	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1215	BcsA	2.01e-11	1	215	53	259	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	1.40e-10	6	189	1	174	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO33451.1	2.14e-109	1	252	1	254
ATP37118.1	3.63e-83	2	250	3	260
AUJ30855.1	1.08e-81	2	250	6	257
APP03582.1	1.16e-78	2	250	3	257
QOG30491.1	1.14e-73	4	251	6	258

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D4GU63	1.83e-11	3	201	19	203	Low-salt glycan biosynthesis hexosyltransferase Agl10 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl10 PE=3 SV=1
P9WMY2	2.49e-11	4	220	5	235	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	2.49e-11	4	220	5	235	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2
P36667	1.83e-09	69	220	60	219	Rhamnosyltransferase WbbL OS=Escherichia coli (strain K12) OX=83333 GN=wbbL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001811_00272.