CAZyme Information: MGYG000001812_00075

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000001812_00075
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
541	MGYG000001812_2|CGC1	62244.42	8.2861

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001812	3064175	MAG	Denmark	Europe

• Gene Location: Start: 29025; End: 30650 Strand: +

Full Sequence      

MREEQQQKNTLDSLTELFVRRNPMRCACVTMTGRQKLCYAAGFLLLLFLLKFRWDCFVFL
VSLFLMLCYGAAALLRMGAALFSLAGSGEVRFAREETRRTPDEDLPVYTLLLPLYRESAV
AEKILARIGRLDYPKEKLDVKLLLEADDSETRAALQRRPLPVWCEIVNVPDGRPRTKPRA
CNYGLAAARGKYCVIYDAEDAPEPDQLRKAVLAFEKEDSDGRLLCVQAKLNYYNARQNWL
TKFFTVEYSTYFDLTLGGLQRFRLPMPLGGTSNHFKTRELREIGGWDPFNVTEDCDLGIR
IYEDGYRTVLLDSTTWEEANSRLWNWMRQRSRWVKGFIQTHLVHFRHPLETIRRLSLRGA
AGCYILVGGSVLMMLLNLVYWPLILLYGVLLIHGMASGESLMSLMTGPHTGEELYRGIQI
GNFSIRAWPLIYAGEGENVFQSLMSQVFFCGSVLLFLSNLFLVLVHLAACLRRRFYFLIP
WALLMPFYWVLISIGAWKGAWQFVTNPFYWEKTIHGLDHGTKWNAMGYTGIEHHGVEHAE
P

Enzyme Prediction     

No EC number prediction in MGYG000001812_00075.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	109	335	5.8e-25	0.9739130434782609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06427	CESA_like_2	1.07e-149	106	348	1	241	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.
COG1215	BcsA	7.68e-48	60	511	9	427	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	6.02e-38	110	294	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06437	CESA_CaSu_A2	1.78e-28	106	337	1	232	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
cd06421	CESA_CelA_like	5.29e-22	106	340	1	233	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44806.1	5.17e-214	11	517	8	512
AEW05577.1	6.42e-127	89	517	332	714
AEJ40069.1	6.42e-127	89	517	332	714
ANE48693.1	4.03e-125	61	517	330	751
QJC50413.1	1.98e-123	15	516	204	670

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YV7_B	9.58e-07	106	309	42	237	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	9.61e-07	106	309	43	238	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	3.96e-21	103	336	46	279	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q6AU53	3.07e-12	102	339	131	376	Probable xyloglucan glycosyltransferase 9 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC9 PE=2 SV=2
Q9SJA2	1.05e-11	104	351	225	477	Probable xyloglucan glycosyltransferase 8 OS=Arabidopsis thaliana OX=3702 GN=CSLC8 PE=2 SV=1
Q9LR87	2.69e-11	93	336	109	357	Probable glucomannan 4-beta-mannosyltransferase 10 OS=Arabidopsis thaliana OX=3702 GN=CSLA10 PE=2 SV=2
P74165	4.05e-11	98	346	88	345	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999852	0.000132	0.000003	0.000000	0.000000	0.000002

TMHMM  Annotations     

start	end
37	54
58	75
363	385
446	468
475	497