CAZyme Information: MGYG000001812_00270

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000001812_00270
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
564		63095.1	6.2721

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001812	3064175	MAG	Denmark	Europe

• Gene Location: Start: 12254; End: 13948 Strand: +

Full Sequence      

MPCEKPKKHFSRLILVSLRKLIEVLQDTADRIEAYLGAAKEDTRDIMARTIDRTYSITEK
IELTNFIKLLTFLMVVLSFITMFISGETLPRVVLISEEVDFTVIILSFLLLIANIFYFAW
QTLLVFQYRNFPLADDSRLPTCAVIVPAYNEGKHIAETLESILKSDYPESKLEIIAVNDG
SRDDTWYWMREAAEKSNGRIRTINLKKNGGKRNALYQGFTTATSEIVVTIDSDSIVLPDT
LRQIVSPFLTDPKIGGVAGNIRVLNLDEGIIPKMLDVSFVFGFEFLRSAQSVIRSVLCTP
GALSAYRRAAIMPHMDEWVHQMFMGTPANIGEDRAITNILIREGYGIVFQKDAVVFTVVP
VTYKGLCKMLIRWGRSNVRENLAMCRFTFRRIDLEDEDLLGLQINLVIQAIWMITPILFL
GTTIYCLFVDAMTFIYSVLMVIIIWSTLPAFVYASRYDKTESLWSYIYGIFNFLTLSWIG
PYSVFTVHRSGWLTRDLPKTASPSSPSSPASSSSPEEKEAQSGNGSDDGQKAVFPSSAGT
PPTEALSASAAILSSASGHANGVK

Enzyme Prediction     

No EC number prediction in MGYG000001812_00270.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	144	311	8.7e-34	0.9647058823529412

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	2.79e-52	144	333	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06434	GT2_HAS	8.34e-49	141	380	1	235	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.
COG1215	BcsA	3.09e-47	88	484	4	400	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	5.33e-44	104	471	19	380	N-glycosyltransferase; Provisional
cd06439	CESA_like_1	7.76e-42	115	356	4	227	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACN17701.1	5.25e-133	109	505	52	447
BCS52180.1	7.92e-133	120	500	66	444
AZQ59560.1	1.29e-128	117	497	86	464
QEE49808.1	2.93e-127	96	495	81	478
ACN15324.1	1.49e-126	119	497	69	445

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SP7_A	2.68e-21	135	380	78	350	ChainA, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]
7SP6_A	1.12e-20	135	380	78	350	ChainA, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP8_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP9_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SPA_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]
6YV7_B	2.47e-15	135	360	37	249	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	2.49e-15	135	360	38	250	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P04341	1.64e-34	139	495	48	395	N-acetylglucosaminyltransferase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=nodC PE=3 SV=1
P50357	4.13e-33	132	501	41	401	N-acetylglucosaminyltransferase OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=nodC PE=3 SV=2
P04340	1.72e-32	135	495	44	394	N-acetylglucosaminyltransferase OS=Rhizobium leguminosarum bv. viciae OX=387 GN=nodC PE=3 SV=1
P17862	1.11e-31	140	495	49	395	N-acetylglucosaminyltransferase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=nodC PE=3 SV=2
Q07755	1.34e-31	140	386	48	293	N-acetylglucosaminyltransferase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571) OX=438753 GN=nodC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
73	95
102	124
407	429
434	453
463	485