CAZyme Information: MGYG000001812_00807

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000001812_00807
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
674	MGYG000001812_24|CGC1	75964.54	6.3533

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001812	3064175	MAG	Denmark	Europe

• Gene Location: Start: 29865; End: 31889 Strand: -

Full Sequence      

MKPIAAAPSRAHEYSRSCTTIDPFYSASEKIPPRRQTEPEVNWLYPRAEYECFQLLQMRR
ITRILKMKVGYTENLHQPSSCVHFRRKADAGILDLRIHGDFKAFLNGTPLKAEKQDGEQI
RFRLPAPGQFLLTVCVDDDGKSLPSIASALPGWEASAPSEENRNTGTDDASFTAACPGGN
PYGEANLAEGVELPLKEFAPGRFDAGREILAEVEIHSPEKPTSFGFGESPAEMENRDPAV
AEQNWELLEKDPGIWKTPAPIAFRYLRAESGKPSMPLRILCRPSVTPVCYRGAFAADEEL
NRIWICSAYTLRMCMQYFLLDGIKRDRLPWVGDLALSVLASAYTFAEAEPIRRSLVALGR
PGIRKTHLNGVVDYSLWYLIAHDSYQLYFSDPDFLQQQYPEISEHIDVLLHHCSPDAFLI
PYDDYEQNFTIDWIDGKKTSALQTLFYWSLHSAARLARRRKDDALEKRCRDHALRLKQSL
FEKAWDPEKGLFFDVPGEPESGFHRHANFLAILGGLTGKEENLRIVKELLNGNLPPAGTP
FMLAFELLAMYRAGEAAAALAKIREVWGGMLQVGATTFFEAWDSRKKNREIYSFYDRPYG
LSLCHAWSSGPAFLLPLIFSGCEATDDGWKSFRAAPLKLVPGQAVTIPTPYGQIEIYEEK
GSFIIESRNRKSCP

Enzyme Prediction     

No EC number prediction in MGYG000001812_00807.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	204	657	6.4e-67	0.9285714285714286

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.24e-20	297	616	10	337	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam06202	GDE_C	2.64e-10	372	501	83	227	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
pfam06832	BiPBP_C	6.37e-04	104	142	49	85	Penicillin-Binding Protein C-terminus Family. This conserved region of approximately 90 residues is found in a sub-group of bacterial Penicillin-Binding Proteins (PBPs). A variable length loop region separates this region from the transpeptidase unit (pfam00905). It is predicted by PROF to be an all beta fold.
pfam17167	Glyco_hydro_36	0.001	432	551	189	330	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.
COG3459	COG3459	0.005	432	530	740	858	Cellobiose phosphorylase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44883.1	5.89e-206	8	654	2	623
BCG53178.1	3.55e-125	6	666	43	700
QTX05357.1	4.37e-92	26	661	22	652
ANF32625.1	1.68e-84	191	667	101	574
SDT18190.1	2.18e-83	8	656	6	659

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	2.70e-50	203	670	196	699	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	4.03e-25	226	615	128	538	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000013	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001812_00807.