CAZyme Information: MGYG000001812_01299

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000001812_01299
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399	MGYG000001812_46|CGC1	44626.89	6.0174

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001812	3064175	MAG	Denmark	Europe

• Gene Location: Start: 8898; End: 10097 Strand: +

Full Sequence      

MPIKAAKAERIRKMQTEILKEYADLALKPPVIRSPVPKRYWPEMDRYTMSCGFTRTPGGR
IWLAWFGIEDGAGAVLLMKHSDDEGESWSDPEFLIDPGFTPSGIHISALVGNVWTEPSGR
LRVFFTQSIGYFDGRAGCWSAVCENPDAEKPVWSRPVRIWHGAGLNKPTILSSGEWLLPL
SLWPRRLICALPGKFPSGVVEDSLYAELDEFRGANVLSSSDGGKSWELRGRQKATDALFD
ENMILEKKDGSLKMYARDSFGIVSCVSSDGGKSWSVFEREFYAASARFFLRALPSGNWLM
VRLDSPAERRANLTAFLSRDEGKSWKESLVLDPGENVSYPDGFLHPDGRIFIQYDHLREH
GEILMAVFTEEDVAAGKNVSGKMLLRKPILQSADLLPDS

Enzyme Prediction     

No EC number prediction in MGYG000001812_01299.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	74	356	3.1e-22	0.6081871345029239

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.97e-39	54	369	20	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	2.93e-22	59	352	1	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam15902	Sortilin-Vps10	0.004	215	327	2	111	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46253.1	4.14e-174	15	393	4	380
QDV28514.1	3.54e-106	20	399	48	423
AMV18709.1	4.21e-105	24	397	45	414
QDU40810.1	8.30e-105	9	389	36	416
QNN20865.1	2.67e-104	9	388	34	413

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001812_01299.