CAZyme Information: MGYG000001812_01303

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000001812_01303
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
213	MGYG000001812_46|CGC1	23988.58	7.2644

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001812	3064175	MAG	Denmark	Europe

• Gene Location: Start: 14315; End: 14956 Strand: +

Full Sequence      

MKTKRKNSPCLRNTAASILFLFLTLLPSFLPSGELQAAEKAGEEPQVRFDELIESIAAKY
TVDPLLVKALIWRESRFLPRSKGAAGEIGLMQIKMAVVKDWAKAKGKEMPNEEEVFDPYL
NIEIGTWHLSRALKNWEGNPDCYALALCEYNAGRTRLLRWIAHYDGSCLHTVKYSASAKY
VRDITDKFIEYTLDHALLESFALRNSAGASDEG

Enzyme Prediction     

No EC number prediction in MGYG000001812_01303.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	61	186	5.6e-18	0.7851851851851852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	4.09e-31	47	184	2	140	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	7.40e-30	49	166	6	120	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
COG0741	MltE	1.53e-22	31	191	121	283	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	2.05e-21	53	162	1	104	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	8.61e-21	64	164	1	92	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDT92021.1	1.58e-36	21	191	5	183
QSR88109.1	5.21e-33	46	191	30	179
QDQ41401.1	5.45e-33	18	191	8	179
QSH40558.1	1.21e-32	46	191	28	175
QSR86051.1	2.53e-32	46	191	30	179

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P57352	8.46e-09	49	159	69	184	Membrane-bound lytic murein transglycosylase E OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) OX=107806 GN=mltE PE=3 SV=1
Q9CLB8	4.32e-08	48	159	189	306	Membrane-bound lytic murein transglycosylase C OS=Pasteurella multocida (strain Pm70) OX=272843 GN=mltC PE=3 SV=2
Q8ZHE6	1.44e-07	52	165	194	312	Membrane-bound lytic murein transglycosylase C OS=Yersinia pestis OX=632 GN=mltC PE=3 SV=2
Q1CEV1	1.44e-07	52	165	194	312	Membrane-bound lytic murein transglycosylase C OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=mltC PE=3 SV=2
Q666M2	1.44e-07	52	165	194	312	Membrane-bound lytic murein transglycosylase C OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=mltC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000721	0.998215	0.000283	0.000273	0.000247	0.000221

TMHMM  Annotations     

start	end
13	30