CAZyme Information: MGYG000001812_01519

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000001812_01519
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
876	MGYG000001812_59|CGC1	98139.88	5.5993

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001812	3064175	MAG	Denmark	Europe

• Gene Location: Start: 10229; End: 12859 Strand: +

Full Sequence      

MLQAYDLRVEYRKNPLGMDETSPRFSYKLSGSSSSQSAYRILVRRSECGEVLWDSGFIPS
GESVQIVYRGAPLQPHTRYDWAVSVRDEEGVEGPWSCEEAFFETGFLGRHWKASWITGSS
ELVWNRRPPQRLAREFTLGERVRKARLRITALGLYEAYINGEGVSANCFTPGWTDYFNRV
QYQVYDVTRLLKGGLNNLSVLLGDGWFCGSIARNWEGGAPTYGKHPALKAELAVEMENGE
SFLLVTDREWSVLPDGPVRMSDIYMGESYDASVDNTAWKQPGFLNSGAVRCGRAVEESHP
SVRMDWQSGADIRRVMELKPRKITRRPSSGVYLVDFGQNLTGRERFCVKNSDPGACIVIR
HGEMLREDGSLYTENLRNALATTTYFCGGKESESYEPVFTFYGFRYLEISGWPGELSADS
ISAQVICSDLEKTGDFSCSDPLLNQLYSNIVWGQRGNFLDVPTDCPQRDERLGWTGDTQV
FANIATYNMYAPAFYTKWITDLNLCLIKGNGCFAHFAPNPYPREGRLPATGWSDAGLICP
KVLFDKYGDTRLLSLYYQHMAHYLDWQISHSGGSYIVSNACYGDWLNMDAPTPEHFISSA
YLCGMLSLLSELAGLIGLGMEAERRSRMAAEAKAAFAKEFFLPDGTICVRTQTAALLAFH
FDLVPEHARTQTAAFLVDDIRNARDLHLSTGFLGTPLLLPVLTKIGEVDLAYELLLQKSF
PGWLYPVTQGATTMWERWNSWSDKDGFGDVGMNSFNHYAYGAVGEWFFESICGISPAEKR
SLGNRAFKRFRLAPCPGNALASAGAEFESPYGKIVSKWRRGDGNSLHWEFTVPCNTVAEI
VFPGKVRTNPEELKGIRIAEGKIEALPGTYEFDLTL

Enzyme Prediction     

EC	3.2.1.40	3.1.1.73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	326	841	6.3e-162	0.9920634920634921
CBM67	113	286	2.5e-26	0.9034090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	6.50e-112	431	771	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.40e-49	141	315	2	171	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	6.11e-35	325	426	1	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	3.20e-18	773	844	1	65	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABQ91107.1	5.19e-218	2	852	4	861
CCW35855.1	7.81e-218	6	843	5	844
QEL04086.1	1.73e-215	2	872	33	901
ACY47587.1	5.61e-215	2	852	20	877
QCT01481.1	8.89e-215	5	844	10	838

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	2.69e-176	9	876	11	1032	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.73e-150	2	845	2	849	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	1.28e-138	5	843	33	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	2.06e-175	9	843	11	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	6.79e-156	13	873	45	921	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	2.59e-139	14	843	42	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	2.37e-96	12	862	40	919	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001812_01519.