CAZyme Information: MGYG000001812_02204

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000001812_02204
• CAZy Family: CE1
• CAZyme Description: S-formylglutathione hydrolase FrmB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
259		29174.58	6.4864

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001812	3064175	MAG	Denmark	Europe

• Gene Location: Start: 7550; End: 8329 Strand: +

Full Sequence      

MAFFECNFFAESLGMCSSMYVVLPQPTRGQIGLKGVGSADGCPVLYLLHGMSDDHSIWLR
RTSIERYAAQYGIAVVMPNVHRSYYNNMVCGLRYWDFISSELPEIVGSFFKFSRKREDTF
AAGLSMGGFGALKLGLNCPEKFAAVAGMSSAIRPAHLASVMKERLPEFENIFGDLSRIPG
SSNDLYFKAEEALANGTRLPEIFLACGTEDFLYQENLLYKAHLEKLGIPFVYREGPGTHE
WGFWDRYIQEILAWLPIRK

Enzyme Prediction     

No EC number prediction in MGYG000001812_02204.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	18	255	7.8e-51	0.9427312775330396

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	2.41e-42	42	258	54	311	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	1.08e-21	23	255	4	246	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2382	Fes	4.43e-16	1	256	71	296	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
PLN02442	PLN02442	1.10e-09	9	250	24	272	S-formylglutathione hydrolase
COG3509	LpqC	6.79e-08	36	161	55	194	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK54961.1	3.97e-16	38	255	170	388
QIK60393.1	5.41e-16	38	255	170	388
BCS34250.1	1.89e-15	43	255	138	342
AHW58566.1	1.95e-15	38	255	178	396
VTR43129.1	1.19e-14	43	248	172	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RGY_A	2.06e-102	1	258	2	264	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]
7L0A_A	4.05e-56	1	255	9	258	ChainA, Esterase family protein [Staphylococcus aureus],7L0A_B Chain B, Esterase family protein [Staphylococcus aureus]
6VH9_A	1.92e-55	2	255	4	252	FphF,Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VHD_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHE_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6WCX_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus]
4ROT_A	6.82e-40	1	257	8	259	Crystalstructure of esterase A from Streptococcus pyogenes [Streptococcus pyogenes]
2UZ0_A	1.99e-37	43	257	42	254	TheCrystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_B The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_C The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_D The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23553	5.32e-42	1	255	1	261	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
Q8FKG2	4.09e-11	43	254	44	269	S-formylglutathione hydrolase FrmB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=frmB PE=3 SV=1
Q8X5J5	5.57e-11	43	254	44	269	S-formylglutathione hydrolase FrmB OS=Escherichia coli O157:H7 OX=83334 GN=frmB PE=3 SV=1
Q0TKS8	7.59e-11	43	254	44	269	S-formylglutathione hydrolase FrmB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) OX=362663 GN=frmB PE=3 SV=1
Q3Z551	1.03e-10	43	254	44	269	S-formylglutathione hydrolase FrmB OS=Shigella sonnei (strain Ss046) OX=300269 GN=frmB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001812_02204.