CAZyme Information: MGYG000001812_02259

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000001812_02259
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
392	MGYG000001812_129|CGC1	44354.95	10.0468

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001812	3064175	MAG	Denmark	Europe

• Gene Location: Start: 116; End: 1294 Strand: -

Full Sequence      

MGEQNKDKLIWIMAGESSGDLYGARIASELRRISPGVRIAGMGGVEMKKAGVDILVDSSE
LGVVGLIEVLGSLFTFIRILLFFTREAARQRPDAVVMVDYPGFNIRFAKRLWKLGIPVIW
YISPQVWVWRKSNIPKLAKYCRKLLVIFPFEPEVWKDSGLDTEFAGHPLVEIVRERTDPS
IRRDPERILLLPGSRKSETSRLMDPFLETALLLRRRHPHLKFAISAPRKKTYEDILMLRD
QFLRKHPGTVLPEMEISWGQTARWMQEASAGLAASGTVTVESAIAGLPLVVAYRLNPLTF
LLAWCIIGKLFRGFFTMVNIILNRKVFEEFLQFQVTPENLADAVERILPGGSRRDEVEKD
MLEMTNALSCGSENATSRSASLILKTIESPRK

Enzyme Prediction     

No EC number prediction in MGYG000001812_02259.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	10	368	1.3e-101	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	5.67e-117	10	392	4	380	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.19e-109	8	388	2	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	7.93e-88	10	361	1	351	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.48e-73	10	375	8	378	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.01e-48	55	385	42	346	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSH40861.1	4.14e-149	6	380	4	379
AVM45461.1	5.90e-131	5	388	9	393
CBE68704.1	1.69e-72	6	389	2	379
SOB59824.1	4.48e-72	1	387	1	374
ACL03491.1	2.57e-69	3	387	2	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	3.97e-46	10	385	9	379	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	3.97e-46	10	385	9	379	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	6.40e-68	8	388	4	379	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q1INL4	9.01e-64	10	388	4	379	Lipid-A-disaccharide synthase OS=Koribacter versatilis (strain Ellin345) OX=204669 GN=lpxB PE=3 SV=1
B3E4H8	9.26e-64	6	388	5	381	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
A0L8R9	2.28e-62	10	348	7	343	Lipid-A-disaccharide synthase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) OX=156889 GN=lpxB PE=3 SV=1
Q39T49	4.06e-62	7	391	6	384	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
61	83
268	290
300	322