CAZyme Information: MGYG000001814_01038

Basic Information

• Species: COE1 sp900753305
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; COE1; COE1 sp900753305
• CAZyme ID: MGYG000001814_01038
• CAZy Family: CE2
• CAZyme Description: Cellulase/esterase CelE

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366	MGYG000001814_5|CGC4	42045.13	4.8799

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001814	3758087	MAG	Denmark	Europe

• Gene Location: Start: 65052; End: 66152 Strand: -

Full Sequence      

METAVKDIKELKVHGRTTDRRDPLTLFWTASGFECNVSGSELWVEVEVTYETYEPWFSYT
VNGDWIGRQMLTAGRYWIPLFRGMNPDKVKNVRFYKDLQAMSADPVSYIHIHALRHDGVF
YPVEDKALKLEFIGDSITSGEGTFGARQEEDWIPMFFSSLRDYAYLTAKELDAEYRVLSQ
SGWGVCNTWDNNPNGALPKYYRQICGLMQSDMNADLGGNENFDFSSWQPDAIVVNLGTND
ASAFDQPEWVDNETGKRHKMHKNPDGSYKEEDIAYFKKAVKDFLHTLRECNPGAQIIWCY
GMLGIPFQKPICQAVYEYVDETQDRKVSYLQLPDTDTDSTGSRQHPGYLSHQRAAKVLSE
FIRTLL

Enzyme Prediction     

No EC number prediction in MGYG000001814_01038.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	129	362	1.2e-61	0.9952153110047847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01831	Endoglucanase_E_like	3.08e-33	129	363	1	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
cd00229	SGNH_hydrolase	4.44e-06	132	298	3	111	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
cd01827	sialate_O-acetylesterase_like1	6.05e-04	227	300	66	115	sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
cd01834	SGNH_hydrolase_like_2	0.002	129	300	3	111	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APO43020.1	1.40e-158	1	366	8	373
QZN77000.1	8.06e-158	4	366	11	373
AYQ74824.1	1.32e-156	4	366	11	373
QKS57722.1	6.64e-155	4	366	13	375
ASA24859.1	6.68e-154	4	366	9	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3U37_A	3.61e-116	3	366	39	404	AnAcetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_B An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_C An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_D An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_E An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_F An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_G An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_H An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316]
4DEV_A	1.17e-114	3	366	39	404	AnAcetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_B An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_C An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_D An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_E An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_F An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_G An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_H An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316]
2WAO_A	1.46e-17	28	366	29	331	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAB_A	3.64e-17	28	366	29	331	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2W9X_A	2.90e-08	129	242	144	250	Theactive site of a carbohydrate esterase displays divergent catalytic and non-catalytic binding functions [Cellvibrio japonicus],2W9X_B The active site of a carbohydrate esterase displays divergent catalytic and non-catalytic binding functions [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10477	2.71e-16	28	366	510	812	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
B3PDE5	1.56e-07	129	242	144	250	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ce2C PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001814_01038.