CAZyme Information: MGYG000001814_01544

Basic Information

• Species: COE1 sp900753305
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; COE1; COE1 sp900753305
• CAZyme ID: MGYG000001814_01544
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
940		107600.99	4.9204

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001814	3758087	MAG	Denmark	Europe

• Gene Location: Start: 91012; End: 93834 Strand: +

Full Sequence      

MQMEKNREKIYSLEGQWQVRLSDGSIYQMLLPGTLDTNDIGYPDKGANQWHPEINLGNAT
ETIDETAPIATRFTRKHTYEGAAVLSRQIDYVPTPGTRVFLEAERARVLRLWVDEQEVSP
VPDSGTLSTPYVFEITGLLKGNNKITLVSDNSYPGLPHDDIVYSSAATDETQTNWNGILG
YIRLREEAENYIESMHVYPHGDLIDINVTVSLSGQSGQPDKLVIQSEIMEQMEYRIGTKE
SFSYDTVQTSYNHDNKIHMLFKNIKLHANVRKWDEYEDNLYTLKVTLYTQTAITDSKDVT
FGIRTFGYNEKGRFTLNNRCIFIRSEANCAEFPEEGHPPMDVESWMNILSRYQEYGINYM
RFHSHCPPDAAFTAADRLGILMQPELSHWNPKDALESEESYQYYKKELKAIIETYANHPS
FVALTLGNELHNQELGQSRMEELVKLAQAMDSTRRYAIASNGYYGARGCDPVSDFYTSQK
YYEKELRGCFAAESEVPGEKGHLLGYINNHYPDAKTDYEQVFASIRRDYDKPVFSFEVGQ
YEILPDFAELSEFKGISDPANFRLIQKRVEDAGLSHIWKEYVEATGELSLIGYREEVEAV
LRTPSMSGISLLGLQDFPGQGTALVGMMNSHLEAKPYDFARPQRFHSFFRETLPLVELEK
YTYETGEVLRAKVQVANYGRQDLEGVLEYQLTGDGIQIKNRFNNNSYAKGSLTCAGEIQI
PLTQWTKACELKLEVRMVDQNKEQMLYNQYPIWVYPVVTPRCPENIYETRYMDKTARTVL
EQGGIVYLSPDATREALPHSIRTQFTTDFWSVGTFAAQEGGMGQYIDVKHPIFRSFPTQK
HTNWQWWSMATQRAVILPGPYQAIVTELDSYAYLRPMAQLIEWQCGKGKVLLSTFGLHNL
LQYPEARALQDAIYHYLGSEEFAPQQHIAMDELTSMVGQV

Enzyme Prediction     

EC	3.2.1.55

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	724	1.4e-54	0.7047872340425532

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	9.57e-14	129	430	110	407	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam00703	Glyco_hydro_2	7.70e-09	191	304	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOV18688.1	0.0	11	937	3	904
QNM03695.1	0.0	13	937	5	947
QQR31292.1	0.0	11	909	3	865
ASB42024.1	0.0	29	909	1	845
ANU54745.1	0.0	29	909	1	845

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T98_A	1.51e-08	269	463	256	454	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
6D1P_A	1.98e-08	175	458	187	465	Apostructure of Bacteroides uniformis beta-glucuronidase 3 [Bacteroides uniformis str. 3978 T3 ii],6D1P_B Apo structure of Bacteroides uniformis beta-glucuronidase 3 [Bacteroides uniformis str. 3978 T3 ii]
5T9A_A	1.36e-07	268	430	258	435	Crystalstructure of BuGH2Cwt [Bacteroides uniformis],5T9A_B Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9A_C Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9A_D Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9G_A Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_B Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_C Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_D Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis]
6S6Z_A	1.92e-07	99	429	128	440	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	1.92e-07	99	429	129	441	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ7	1.42e-14	131	458	152	468	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	2.26e-09	129	517	103	465	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
Q56307	1.05e-06	99	429	129	441	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001814_01544.