CAZyme Information: MGYG000001817_00225

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; Monoglobaceae; UMGS1820
• CAZyme ID: MGYG000001817_00225
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
584		67416.28	4.5851

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001817	2450374	MAG	Denmark	Europe

• Gene Location: Start: 14; End: 1768 Strand: -

Full Sequence      

MNFKIESTTNITSSVSRVNDFGSAEIYKLNLKWDKNNIKPNDKVKVYFEYPMAEITNVWL
PNSAPLFGLPREIKPSWKETGIISSIAVSAPVMTFYDNADKNHLTIALSETKKTIRFNFG
TEEKAASLGCSFEISLIQYTDTDETELYLFVDKSDSYMYESIENVIDWWENEIEIKPMNV
PDSAFDPLYSFWYSYHQDVYEKDVEDECQYAKDFGFKNVIVDDGWQTDDNNGGYAYCGDW
EVCNNKFSDFAAHVKRVHAMGLKYILWFSVPFVGEKSKNWNRFKDMILYKNKDLGAGVLD
PRYKEVRDFLTSLYKDAVTEWDLDGFKLDFIDSFSNPDNIPANEKMDIPDLQDAIDALMV
NIRKELTSIKSDILIEFRQKYIGPNIRKYGNMLRAADCPYDYLSNRISTLDLRLSSGETA
VHSDMLMWNNDEKPEVAAIQIINSIFSVVQISVKLNDLPESHKKMLRFWVKFMDENKDLL
LRSKLIVREPHMYYTSATAYDEKREISAVYSNDKCIEVNHSESVIINGTARDYIILSFSE
QGKYNFKVLDCMGNTVDESTIDADEKLQKINVPTSGMIELSIVK

Enzyme Prediction     

No EC number prediction in MGYG000001817_00225.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	1.43e-61	187	472	4	296	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06592	GH31_NET37	1.94e-14	187	350	3	171	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG3345	GalA	9.77e-09	125	330	236	451	Alpha-galactosidase [Carbohydrate transport and metabolism].
COG1649	YddW	1.22e-06	254	375	121	268	Uncharacterized lipoprotein YddW, UPF0748 family [Function unknown].
pfam02638	GHL10	1.10e-05	258	441	80	292	Glycosyl hydrolase-like 10. This is family of bacterial glycosyl-hydrolase-like proteins falling into the family GHL10 as described above,.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO31288.1	9.46e-162	5	581	7	584
QJU17504.1	3.10e-152	39	579	46	583
QJD86820.1	4.50e-150	14	580	21	600
QOV11148.1	2.53e-148	2	578	6	583
AZN41080.1	6.62e-146	44	581	55	598

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.996673	0.003108	0.000116	0.000028	0.000014	0.000075

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001817_00225.