CAZyme Information: MGYG000001818_00790

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; QAKW01; HGM12957
• CAZyme ID: MGYG000001818_00790
• CAZy Family: CE15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341		38133.11	5.0973

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001818	1547538	MAG	Denmark	Europe

• Gene Location: Start: 2724; End: 3749 Strand: -

Full Sequence      

MYLSDKLPDPSGLEQRAIVDLLLREEYGYLPARPYRVSASLESEDKKFCAGKASLKKLIL
RCQAEWGEFSFPIYYVCPLYTDAPVPCFIHINFRSLIPDKYQPTEELVDSGYAVLTFCYL
DVTSDSADFTDGLAGVIYPDGERKSDACGKIGLWAWAASAVMDYAVTLPELDRHKISVAG
HSRLGKTALLAGALDERFYCAFSNNSGCSGAALARGADGETVKAITDKFPYWFCENYLKY
SGKEDTMPFDQHYLIAANAAHRVYVASAEGDLWATPQNEYLACVAASDYYKSQGLRGFVH
PDRLPYAGECMHEGDIGYHLRSGVHYLSREDWLCYIKYLNN

Enzyme Prediction     

No EC number prediction in MGYG000001818_00790.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE15	15	340	2.1e-62	0.8921933085501859

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1506	DAP2	2.26e-04	107	209	419	508	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE95892.1	3.43e-111	15	339	33	357
ALL53565.1	9.99e-80	14	338	33	354
QTN32611.1	2.35e-76	14	332	87	413
QNK58798.1	2.07e-73	18	338	34	366
QOV20253.1	4.01e-73	14	338	32	354

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GRW_A	4.27e-53	103	338	156	392	GlucuronoylEsterase from Opitutus terrae (Au derivative) [Opitutus terrae PB90-1],6GS0_A Native Glucuronoyl Esterase from Opitutus terrae [Opitutus terrae PB90-1]
6SYU_A	6.44e-53	103	338	174	410	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with xylobiose [Opitutus terrae],6T0I_A The wild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with the aldotetrauronic acid XUX [Opitutus terrae]
6SYR_A	9.18e-53	103	338	185	421	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1]
6SYV_A	1.78e-52	103	338	174	410	Theglucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1],6SZO_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-galacturonate [Opitutus terrae PB90-1],6T0E_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1],6T0E_B The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1]
7B7H_A	4.90e-52	103	338	174	410	ChainA, Putative acetyl xylan esterase [Opitutus terrae PB90-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0K2VM55	7.09e-50	94	341	179	425	Carbohydrate esterase MZ0003 OS=Unknown prokaryotic organism OX=2725 GN=MZ0003 PE=1 SV=1
G0RV93	2.26e-19	1	310	117	412	4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=cip2 PE=1 SV=1
P0CU53	6.01e-16	2	299	40	346	4-O-methyl-glucuronoyl methylesterase 1 OS=Wolfiporia cocos (strain MD-104) OX=742152 GN=WOLCODRAFT_23632 PE=1 SV=1
B2ABS0	6.53e-14	15	265	145	383	4-O-methyl-glucuronoyl methylesterase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=ge1 PE=1 SV=1
A0A0A7EQR3	8.98e-13	2	295	107	406	4-O-methyl-glucuronoyl methylesterase OS=Cerrena unicolor OX=90312 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001818_00790.