CAZyme Information: MGYG000001821_00219

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS1865
• CAZyme ID: MGYG000001821_00219
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
735	MGYG000001821_2|CGC1	82642.84	5.7312

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001821	2502425	MAG	Denmark	Europe

• Gene Location: Start: 80116; End: 82323 Strand: +

Full Sequence      

MTQSDFFGTAKWVGVSERASDTFSVLRGHFLIERADRVTLNVLGLGFFKCYINGICVNPD
TFLPLSSDFESGCDPIDEELSGHRVYVPSFDITPLVRAGDNVIAIHFGGGWDTHPSRTFG
LPKAIYRIMAENEGKIAFFESDETCRIGGSFVESYQFVRYEKHDYRIEDAWKSLDFDDRA
WKFATVCEGLDTEYCSTDCPADALIRTLEPKRIGNGAEGIVYDCGINTSGYPVLTLQAAR
GERVCIRFSEALAPNGTLDPTHMHKQEFSIVSGGACDRTVQPEFTWFGFRYFEVIGNATP
IGVKEIHADISPSSSFTCDNETLNWIYRTFLHTMLTNMHTGHPSDCPHLERRGYTGDGQL
TCHAVLTTLNAKSFYEKWLQDIADSQDKLTGHIQYTAPYLRSGGGPGGWGCAIIEVAYQL
YCHYGDREILSRYYENMRRYLDYLDAHSEFELVTSDKDGEWCLGDWCGPNILYPELEILS
HRQQVMLPAPMVNTYFMVKSLGRMCEIARVIGRDSDVREYEEKAALRKNAIRAAYFNTFD
GNFIMNVQGANTYAVDLGLGNEKTYPNTVAYYKKLGHYDTGIFATDILTRILFERGDADL
ALDLLTNNGAQGFAHWKENGATTFHEYWDSNRSRSHNHPMFGAPVAYFFEYLLGIRQASG
SAGYKSLVIAPQGVSRFDFMRGSMQTPHGNVSVEYKKQADGIHFSVHVPSGVRAQFQYNG
RQIDLIGGKTASFTL

Enzyme Prediction     

No EC number prediction in MGYG000001821_00219.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	219	715	1.8e-121	0.9781746031746031

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.94e-70	314	652	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	7.65e-14	211	298	1	88	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.26e-12	37	186	5	152	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	7.45e-10	654	714	1	59	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
PRK11162	mltA	0.006	525	597	160	221	murein transglycosylase A; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS97255.1	8.67e-181	7	729	3	719
BCJ98018.1	4.23e-116	1	726	118	866
QOY86540.1	2.42e-104	10	714	132	838
QUT50058.1	8.21e-101	9	714	141	854
AWY99317.1	1.84e-97	30	717	148	836

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	2.80e-63	10	709	147	889	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	3.08e-50	7	715	287	991	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	2.30e-28	40	721	149	849	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	8.98e-59	31	730	193	920	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	2.07e-52	10	716	148	876	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	1.63e-49	7	715	287	991	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	2.47e-46	10	717	151	877	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
T2KM26	2.04e-12	289	729	700	1142	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001821_00219.