CAZyme Information: MGYG000001821_00923

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS1865
• CAZyme ID: MGYG000001821_00923
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
740	MGYG000001821_12|CGC1	83234.96	4.6469

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001821	2502425	MAG	Denmark	Europe

• Gene Location: Start: 28908; End: 31130 Strand: +

Full Sequence      

MNKQFIAASRIPADFDTPVAAPYLRKSFSLDAVPSEAKIEICGLGFYALWINGREITKGP
MAPYVSNPDDLCYYDTYDLSGLLTAGKNTVGILLGNGWMNPFGGGVWDFDQAAWRGAPCV
ALELTARVGEAEICICADESFRTHPSPLLFDELRMGEHYDARLEIDGWNLPDFDDADWAP
AICISNAVRGEMKPCTAEPIAVYDEVRPVSITKTEDGYLYDFGINSAGVCRLSVEGEAGQ
RIQMQHCEMLKDGKFFLENIIFKGRHEPIYAHTEHVYIYDYTLNGRGKEIWTPRFSYMGF
RYVLVRGITEEQATPELLTYLRMSSELRPIASFSCSNERVNRLWEMAQNSIRSNFYYFPT
DCPHREKNGWTGDASMSSDMTTLFYDTEQSYRQWLEGIRKAQNDRGELPGIVPTGGWGYA
WGNGPAWDSVLFNLPYMLYHYRGNTDVIRENAHAMMRYLEYVMTRRSEDGTIAIGLGDWV
PTGKRKASAYDSPLALTDSTMIMDIARKAAEMLEAIGQTHAAAYAGAIADDMRATIRREL
LDTETATLAGNCQTSQALGLYYDIFDENERRPAFEKLLEFIHAKGDSFDCGFLGLHTIFH
VLSDFGENELAYRMIMKPDYPSYAYLIDVGETAIPEWILEPADLATRASHNHHFLGDFSR
WFLTRLAGLCPLDACTLTLRPSFPADVDHADATYEFPTGVASVSWTRTGDRIVLNVSIPE
GVNCKTDELAPNVELHLNRV

Enzyme Prediction     

No EC number prediction in MGYG000001821_00923.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	214	725	1.1e-122	0.9841269841269841
CBM67	17	183	1.6e-30	0.8806818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	7.84e-77	331	662	4	336	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.37e-36	34	202	3	170	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.65e-21	212	324	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.47e-09	676	725	11	60	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ48940.1	2.96e-135	21	719	155	855
QUT48046.1	1.37e-133	21	727	140	840
QGQ94103.1	1.38e-133	19	731	141	841
BBK91320.1	3.15e-133	21	727	145	844
QRO16731.1	2.99e-132	21	727	140	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	3.00e-80	21	719	176	889	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	4.57e-72	6	709	116	820	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	5.75e-71	20	719	301	985	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	1.43e-75	20	719	183	897	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	4.77e-71	23	725	172	875	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KNB2	7.03e-71	23	734	176	884	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	2.82e-70	20	719	301	985	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001821_00923.