CAZyme Information: MGYG000001821_02063

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS1865
• CAZyme ID: MGYG000001821_02063
• CAZy Family: GH13
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
645		72938.99	5.8716

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001821	2502425	MAG	Denmark	Europe

• Gene Location: Start: 1422; End: 3359 Strand: +

Full Sequence      

MKKAAPLVAETQQKRVAEQDTNENGRSRAQAFHSGSDARAYEYLGFHRDGDCALFRVWAP
HAEFVSVIGDFNAWDDTATPLVPVDGQGAWEVSVDSSAVCDGSFYKFCIRNGSRRLEKAD
PFARAAEAPPNTASVIRSRDAHAWRDAGWMRYRRGKFTRERAAEQPINIYEVHAGSWRRH
ADGRPYSYAELGAELVHYVKQMGYTHVELMPLAEHPFDGSWGYQVSGYFAPTARYGSPEQ
LMELVDTLHEAGIGVILDWVPAHFPKDAHGLCEFDGQPLFEYALPHRMEHPTWGTRCFDL
GRPEVRSFLLSSAVYWIETFHLDGLRVDAVASMLYLDFDRASGQWTPNSCGGTTDPDAAE
FFRTLNRITAEQYPDVMLIAEESAARERLTDGEGGLGFTFKWNMGWMNDSLSYWKKTTRE
RGFAHRELTFSFDYAFDERYILPISHDEVVHGKRSLLDRNPGSYEEKFAGARTYLAYMMT
HPGKKLLFMGCEIGQFCEWRYDGEVEWFLLDYEKHAALQLLAAELNHLYLSEPALWELDR
DPAGFAPTDLTNAAQRILSYRRRAKDGTELTVVLNLAPTGYDEFLLAVSEKGNYVELINT
DAARFGGNGIENRGLRPTAPATLCGLPHAIRIKLPPLSGLVFKRV

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	198	495	5e-140	0.9933554817275747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01515	branching_enzym	0.0	32	643	5	618	alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase. This model describes the glycogen branching enzymes which are responsible for the transfer of chains of approx. 7 alpha(1--4)-linked glucosyl residues to other similar chains (in new alpha(1--6) linkages) in the biosynthesis of glycogen. This enzyme is a member of the broader amylase family of starch hydrolases which fold as (beta/alpha)8 barrels, the so-called TIM-barrel structure. All of the sequences comprising the seed of this model have been experimentally characterized. This model encompasses both bacterial and eukaryotic species. No archaea have this enzyme, although Aquifex aolicus does. Two species, Bacillus thuringiensis and Clostridium perfringens have two sequences each which are annotated as amylases. These annotations are aparrently in error. GP|18143720 from C. perfringens, for instance, contains the note "674 aa, similar to gp:A14658_1 amylase (1,4-alpha-glucan branching enzyme (EC 2.4.1.18) ) from Bacillus thuringiensis (648 aa); 51.1% identity in 632 aa overlap." A branching enzyme from Porphyromonas gingivales, OMNI|PG1793, appears to be more closely related to the eukaryotic species (across a deep phylogenetic split) and may represent an instance of lateral transfer from this species' host. A sequence from Arabidopsis thaliana, GP|9294564, scores just above trusted, but appears either to contain corrupt sequence or, more likely, to be a pseudogene as some of the conserved catalytic residues common to the alpha amylase family are not conserved here. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK14705	PRK14705	0.0	35	643	614	1221	glycogen branching enzyme; Provisional
cd11322	AmyAc_Glg_BE	0.0	129	531	2	402	Alpha amylase catalytic domain found in the Glycogen branching enzyme (also called 1,4-alpha-glucan branching enzyme). The glycogen branching enzyme catalyzes the third step of glycogen biosynthesis by the cleavage of an alpha-(1,4)-glucosidic linkage and the formation a new alpha-(1,6)-branch by subsequent transfer of cleaved oligosaccharide. They are part of a group called branching enzymes which catalyze the formation of alpha-1,6 branch points in either glycogen or starch. This group includes proteins from bacteria, eukaryotes, and archaea. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
PRK12313	PRK12313	0.0	32	643	15	626	1,4-alpha-glucan branching protein GlgB.
PRK12568	PRK12568	0.0	55	640	142	724	glycogen branching enzyme; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK41917.1	2.19e-217	32	643	17	629
ARP51003.1	7.20e-216	32	644	16	630
QKN23269.1	7.20e-216	32	644	16	630
QKO30049.1	1.02e-215	32	644	16	630
CAB1243441.1	3.00e-215	31	643	16	629

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JOY_A	2.52e-188	34	643	14	617	TheX-ray Crystallographic Structure of Branching Enzyme from Rhodothermus obamensis STB05 [Rhodothermus marinus]
3K1D_A	3.10e-182	32	640	109	717	Crystalstructure of glycogen branching enzyme synonym: 1,4-alpha-D-glucan:1,4-alpha-D-GLUCAN 6-glucosyl-transferase from mycobacterium tuberculosis H37RV [Mycobacterium tuberculosis H37Rv]
5GR3_A	2.82e-175	32	643	137	772	Crystalstructure of branching enzyme L541A/W655A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQW_A	2.82e-175	32	643	137	772	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR2_A	7.96e-175	32	643	137	772	Crystalstructure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GR4_A Crystal structure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5NXV7	1.27e-202	32	640	18	623	1,4-alpha-glucan branching enzyme GlgB OS=Aromatoleum aromaticum (strain EbN1) OX=76114 GN=glgB PE=3 SV=1
Q21WG7	1.76e-202	32	645	10	622	1,4-alpha-glucan branching enzyme GlgB OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) OX=338969 GN=glgB PE=3 SV=1
O66936	5.46e-200	32	643	15	627	1,4-alpha-glucan branching enzyme GlgB OS=Aquifex aeolicus (strain VF5) OX=224324 GN=glgB PE=3 SV=1
Q81ZU6	1.53e-196	32	643	117	730	1,4-alpha-glucan branching enzyme GlgB OS=Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) OX=228410 GN=glgB PE=3 SV=1
Q0AGJ0	1.63e-195	32	641	119	730	1,4-alpha-glucan branching enzyme GlgB OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999998	0.000019	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001821_02063.