CAZyme Information: MGYG000001822_02078

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Christensenellaceae
• CAZyme ID: MGYG000001822_02078
• CAZy Family: GH94
• CAZyme Description: Cyclic beta-(1,2)-glucan synthase NdvB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
570		64813.9	6.6036

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001822	2406608	MAG	Denmark	Europe

• Gene Location: Start: 44; End: 1756 Strand: +

Full Sequence      

MGMLQKTWALKPGEGTSVFLCLGAEKNSDEAIALLHRYRQQNSQEPEVCPKCINHLQQTV
ERQNGVLSIQTPNKALDILFNHWLLYQVRVSRWLTKTGYFQSGGAIGFRDQLQDMLALIY
SDPQLVRSHILDCAAHQFVEGDVLHWWHQPAKGVRTAIRDDLLFLPYVTLEYLRITADWS
ILQEQVPYLISQEIPQGQQDLYASFDVGEMTETLQQHIQRALHRSWNLGELGLPKMGRGD
WNDGMDQVGAKGQGQSVWLGFFLVHIAKRWSRLLEYKGEMAQSVKYRNMAEKLKETLNQM
AWDGEWYLRAFFDDGSPLGSEKNQECQIDLISQAWSVISGVAGKDRRKKAMDSAISKLLD
RDSGVFSLLTPPFDGRGNDPGYIRGYIPGVRENGGQYTHGAIWGLAALCLLGEKDKAYEV
MNLLNPIVRTQRYLLAQKYAGEPYCMAADVYASAHHRGRAGWTWYTGSGAWMYKVVLEYV
LGFWKEGDLLSILPCLPAEAFPYTIDYRHGKALYHIEVDLWEEPLDPSIEDGGKGGIKQM
IWVDGNRVREIRLKDDGLSHRVQVVISREG

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH94	2	564	4.2e-192	0.5164092664092664

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3459	COG3459	3.09e-163	10	518	520	1017	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
pfam17167	Glyco_hydro_36	3.00e-123	69	482	11	423	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVX30049.1	8.86e-163	2	566	2214	2766
AVX19642.1	8.86e-163	2	566	2214	2766
QJW54552.1	1.20e-161	2	568	865	1415
QSQ07709.1	2.87e-161	10	568	2313	2858
SQI43741.1	2.90e-161	2	568	740	1290

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QDE_A	2.71e-57	10	566	250	810	ChainA, Cellobiose phosphorylase [Acetivibrio thermocellus],3QDE_B Chain B, Cellobiose phosphorylase [Acetivibrio thermocellus]
1V7V_A	3.96e-52	2	519	246	762	Crystalstructure of Vibrio proteolyticus chitobiose phosphorylase [Vibrio proteolyticus],1V7W_A Crystal structure of Vibrio proteolyticus chitobiose phosphorylase in complex with GlcNAc [Vibrio proteolyticus],1V7X_A Crystal structure of Vibrio proteolyticus chitobiose phosphorylase in complex with GlcNAc and sulfate [Vibrio proteolyticus]
4ZLE_A	8.50e-49	3	540	253	780	Cellobionicacid phosphorylase - ligand free structure [Saccharophagus degradans 2-40],4ZLF_A Cellobionic acid phosphorylase - cellobionic acid complex [Saccharophagus degradans 2-40],4ZLG_A Cellobionic acid phosphorylase - gluconic acid complex [Saccharophagus degradans 2-40],4ZLI_A Cellobionic acid phosphorylase - 3-O-beta-D-glucopyranosyl-alpha-D-glucopyranuronic acid complex [Saccharophagus degradans 2-40]
2CQS_A	3.88e-48	10	566	275	842	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQS_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQT_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],2CQT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],3QFY_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFY_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFZ_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QFZ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus]
3ACT_A	3.29e-47	10	566	275	842	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Histidine mutant [Cellulomonas gilvus ATCC 13127],3ACT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Histidine mutant [Cellulomonas gilvus ATCC 13127]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20471	3.79e-118	65	529	2350	2816	Cyclic beta-(1,2)-glucan synthase NdvB OS=Rhizobium meliloti (strain 1021) OX=266834 GN=ndvB PE=1 SV=2
Q9F8X1	4.70e-56	2	566	246	799	N,N'-diacetylchitobiose phosphorylase OS=Vibrio furnissii OX=29494 GN=chbP PE=1 SV=1
B9K7M6	1.38e-55	27	566	281	812	Cellobiose phosphorylase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=cbpA PE=1 SV=1
Q76IQ9	1.51e-51	2	545	246	801	N,N'-diacetylchitobiose phosphorylase OS=Vibrio proteolyticus OX=671 GN=chbP PE=1 SV=1
Q8P3J4	2.88e-43	4	557	267	798	Cellobionic acid phosphorylase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=XCC4077 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001822_02078.