CAZyme Information: MGYG000001823_01559

Basic Information

• Species: UMGS1603 sp900553265
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; UMGS1603; UMGS1603 sp900553265
• CAZyme ID: MGYG000001823_01559
• CAZy Family: GH4
• CAZyme Description: Alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
440	MGYG000001823_41|CGC1	49435.34	5.4844

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001823	2784400	MAG	Denmark	Europe

• Gene Location: Start: 2402; End: 3724 Strand: +

Full Sequence      

MPRKIAFIGAGSFGFTRSLVRDLLSFPALADADISLMDVDPERLDAIYRACKRIAEEGHY
PARITATTDRVEALKGADGVVTTILQGGCDVWQHDILIPKKYGVDTNVGDTRGPSGIFRY
LRTINPILDIAADIDRYCPGAVYLNYTNPMAMLCRTVQGVYPHLTTSGLCHSVQGTASML
AKWIGAKDEEVTYTCAGINHQAFYTEFLVNGKDAYPLIRKAVTERPEVYNEEIVRNEMFL
ALGYYVTESSGHNSEYNAWFRKRPDLIEKYCKPGTGWNPGEYAYILHEYRNREHTWRDEI
DKWFKEPVDLNRGHEYAASIFNAIFGDGEMFKFNGNVRNFGLIDNLPEGCCVEVPVLASR
RGLEPIHVGKMPPQLAILSGTSAQIEEMAVQASLTGDRELVYQAICYDPLTAAVCSLREI
RSMVDEMFAINEPFLTQFKK

Enzyme Prediction     

No EC number prediction in MGYG000001823_01559.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	4	183	1.2e-59	0.9888268156424581

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15076	PRK15076	0.0	1	439	1	431	alpha-galactosidase; Provisional
cd05297	GH4_alpha_glucosidase_galactosidase	0.0	4	428	2	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	1.11e-137	4	440	5	441	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
cd05296	GH4_P_beta_glucosidase	1.03e-62	3	435	1	419	Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
pfam02056	Glyco_hydro_4	1.57e-57	4	182	1	179	Family 4 glycosyl hydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS96821.1	3.74e-231	3	439	2	437
BAL99323.1	8.49e-226	1	440	1	439
QHT62813.1	3.30e-218	3	439	2	436
AVM46579.1	1.26e-216	1	438	1	438
BAJ62435.1	1.70e-214	4	439	3	439

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C3M_A	1.23e-42	4	440	6	439	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
3FEF_A	4.59e-40	4	410	7	420	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
1S6Y_A	2.33e-39	4	440	9	442	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
1OBB_A	2.95e-35	4	432	5	469	alpha-glucosidaseA, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8],1OBB_B alpha-glucosidase A, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8]
1U8X_X	1.10e-25	8	434	33	460	CrystalStructure Of Glva From Bacillus Subtilis, A Metal-requiring, Nad-dependent 6-phospho-alpha-glucosidase [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P06720	2.14e-98	4	435	6	445	Alpha-galactosidase OS=Escherichia coli (strain K12) OX=83333 GN=melA PE=1 SV=1
P30877	3.35e-94	4	435	6	445	Alpha-galactosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=melA PE=3 SV=2
Q9X4Y0	1.11e-89	4	438	5	442	Alpha-galactosidase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=melA PE=3 SV=1
O34645	9.07e-86	3	439	2	432	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1
Q9AI65	9.37e-52	1	439	1	453	Alpha-glucosidase OS=Erwinia rhapontici OX=55212 GN=palH PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001823_01559.