CAZyme Information: MGYG000001823_02111

Basic Information

• Species: UMGS1603 sp900553265
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; UMGS1603; UMGS1603 sp900553265
• CAZyme ID: MGYG000001823_02111
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
693	MGYG000001823_76|CGC1	77479.68	5.1385

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001823	2784400	MAG	Denmark	Europe

• Gene Location: Start: 5557; End: 7638 Strand: -

Full Sequence      

MIQNAKWILCPHRYGPMGKAEASPEFRKEFELARAPKSATLQICGLGFFDAKINGQSVTE
RLLTPPFTAYDKRVYFEEYDVSALLKAGKNEIRVQLGGGWYCTAIRDAWQFEAAPWKGPM
QMIASLIADGETVTSTGSDWQARESKMIESELRGGEICDATFEQGEWMQAVVHRGAGGRL
MKYDGPGIVIEKVLEPASVTVVEDGAIYDFGENLAGNCEFTVTGARGDHMVAEYGERLDG
RGGLDTENIATFCWEHRFQTDEYICAGEGEETWHGLFTYHGFRYVKITGAAKVVSVRARV
FHTELPQKGGFECDSEVLNAIQDAVLRSTRTNYHHMPTDCPHREKNGWTGDAHLSCEQAL
FNLDMAPAYRKWLNDFEDAQRPTGELPGILPTGGWGYVWGNGVSWDCACIVIPWQTYMAT
GDVRFLTEHYGLMDRYIDYMASVAENGISTIGLGDWCPPKEAKPFPTEALLTGISIHLYE
MMVKIAEITGHSGTKFARLAEETRAAFHREFDGRVPDSQAYLSMLLFFNLTDDREGVAKR
LVHEVRQANGHILTGIFGAKFLLQALTDAGEVETAYEIAAQKEYPGWYHMLSNGSGTLWE
DWTGENSLNHHMFSPISAWFYRGIAGITILEPGYRRVRIAPSIPSEIRFFRAWHDAPMGR
LTVEWKDGKLTVTAPAGMEVELDAAVPAELKRI

Enzyme Prediction     

No EC number prediction in MGYG000001823_02111.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	204	682	2.8e-140	0.9821428571428571
CBM67	5	170	1.7e-22	0.875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.28e-92	306	624	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.04e-33	35	170	2	140	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.57e-26	207	302	9	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.65e-09	626	682	1	61	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ94103.1	2.67e-163	5	691	125	845
QNM09766.1	2.46e-162	6	678	8	680
AYB33152.1	4.17e-158	4	667	150	855
QNN24933.1	3.83e-155	2	666	329	1032
AHF16194.1	2.08e-153	4	676	138	853

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	3.39e-102	4	682	146	896	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	3.24e-91	15	689	290	997	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	2.46e-80	25	687	133	837	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	1.48e-90	15	689	290	997	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	3.95e-89	4	666	150	856	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
T2KPL4	2.10e-85	22	693	183	914	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	1.91e-77	4	681	147	875	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001823_02111.