CAZyme Information: MGYG000001825_00499

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-269
• CAZyme ID: MGYG000001825_00499
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337		39606.16	9.6618

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001825	1360030	MAG	Denmark	Europe

• Gene Location: Start: 4137; End: 5150 Strand: +

Full Sequence      

MKKVLFYSSVPSKKLFYTQRFYYIDISLLQDLGCEVILSNHILDALLFWKYDFVFAYFYR
KSFFVGLLARLLRKNVYFTGGIDDLDKEYASFMRYHIQKIFMKLCYFVATSCIIVSKADM
NNVIKVLRTKNKLSYSEHTIDITNFMKDEIVKENFFTTIVWMGNVNNVKRKGVDIALYVF
SILKQNTLFSDYKFIIIGKVGEGTSYLRSLIVKYNLTNDVIITDEISETSKIDYLKRSKY
YFQLSFYEGFGLAALEALVAKNIVIHSAKGGLSNPVFASGIHFNIEHDKRIESRKLLDTL
TYYTSSKQEANVQYMYQYYNNKRRKDDFMKIIIDLIF

Enzyme Prediction     

No EC number prediction in MGYG000001825_00499.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	157	285	2.6e-19	0.78125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	4.57e-17	40	273	72	303	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	6.08e-17	3	273	51	312	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00534	Glycos_transf_1	4.34e-16	168	272	12	113	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03811	GT4_GT28_WabH-like	9.27e-13	50	265	83	290	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03807	GT4_WbnK-like	4.79e-11	50	271	79	298	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA31361.1	1.16e-122	2	334	3	331
QUT62952.1	1.16e-122	2	334	3	331
QQA28345.1	1.40e-120	1	334	1	330
QUT63675.1	1.40e-120	1	334	1	330
BBK88238.1	1.40e-120	1	334	1	330

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BFW_A	3.80e-07	170	272	49	150	Structureof the C domain of glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi]
3L01_A	1.15e-06	170	272	264	365	ChainA, GlgA glycogen synthase [Pyrococcus abyssi],3L01_B Chain B, GlgA glycogen synthase [Pyrococcus abyssi]
2BIS_A	1.17e-06	170	272	265	366	Structureof glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi],2BIS_B Structure of glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi],2BIS_C Structure of glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi]
3FRO_A	1.17e-06	170	272	264	365	Crystalstructure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi],3FRO_B Crystal structure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi],3FRO_C Crystal structure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi]
6KUW_A	1.25e-06	170	272	258	359	Crystalstructure of human alpha2C adrenergic G protein-coupled receptor. [Homo sapiens],6KUW_B Crystal structure of human alpha2C adrenergic G protein-coupled receptor. [Homo sapiens]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999932	0.000067	0.000009	0.000001	0.000000	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001825_00499.