CAZyme Information: MGYG000001826_00229

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Bulleidia
• CAZyme ID: MGYG000001826_00229
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
244	MGYG000001826_5|CGC1	28089.76	4.7854

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001826	2168112	MAG	Denmark	Europe

• Gene Location: Start: 8139; End: 8873 Strand: -

Full Sequence      

MARMSCNVISYTLKRTVNIEIVLPTVTIPEALMNEGKVHHDYPAPFPVLYLLHGYGNNEK
QWTGYSNVELYAEERQIAVVMIAGENKFYLDSETDRFAAFIDNELHEFVTNTFPVSKKKE
DTYIAGLSMGGFGALYHGLTHPELYQAIGAFSPAVKMQGVDVDLSRNVEEMNTIPDLYIA
CGEDDFIYDDAKAFALCAKEKFQNVTWKSVPHFAHEWRFWDQQVEQFLDWLPRTDYYNDK
KRSV

Enzyme Prediction     

No EC number prediction in MGYG000001826_00229.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	42	231	1.2e-44	0.8854625550660793

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	1.10e-25	45	233	53	310	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	3.63e-18	45	234	23	246	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2382	Fes	1.95e-12	41	234	91	298	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
PLN02442	PLN02442	5.47e-07	46	153	47	176	S-formylglutathione hydrolase
COG2819	YbbA	8.01e-07	95	154	114	171	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMV27398.1	3.15e-19	46	241	13	224
VTR92900.1	6.10e-19	46	233	85	288
QNI36504.1	6.71e-18	45	231	178	383
AFL84745.1	6.85e-18	26	227	63	289
VTR92875.1	6.96e-18	23	233	55	288

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RGY_A	1.99e-34	1	232	2	262	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]
7L0A_A	5.69e-22	1	231	9	258	ChainA, Esterase family protein [Staphylococcus aureus],7L0A_B Chain B, Esterase family protein [Staphylococcus aureus]
4ROT_A	6.44e-22	47	243	47	268	Crystalstructure of esterase A from Streptococcus pyogenes [Streptococcus pyogenes]
6VH9_A	2.67e-21	2	231	4	252	FphF,Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VHD_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHE_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6WCX_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus]
2UZ0_A	1.13e-18	36	232	31	253	TheCrystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_B The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_C The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_D The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23553	3.11e-31	1	234	1	264	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
Q8X5J5	2.10e-10	47	155	44	172	S-formylglutathione hydrolase FrmB OS=Escherichia coli O157:H7 OX=83334 GN=frmB PE=3 SV=1
B1XEU8	1.81e-09	10	155	21	172	S-formylglutathione hydrolase FrmB OS=Escherichia coli (strain K12 / DH10B) OX=316385 GN=frmB PE=3 SV=1
B1J086	1.81e-09	10	155	21	172	S-formylglutathione hydrolase FrmB OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks) OX=481805 GN=frmB PE=3 SV=1
P51025	1.81e-09	10	155	21	172	S-formylglutathione hydrolase FrmB OS=Escherichia coli (strain K12) OX=83333 GN=frmB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001826_00229.