CAZyme Information: MGYG000001826_00280

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Bulleidia
• CAZyme ID: MGYG000001826_00280
• CAZy Family: GH170
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393	MGYG000001826_6|CGC1	45430.73	4.729

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001826	2168112	MAG	Denmark	Europe

• Gene Location: Start: 10496; End: 11677 Strand: +

Full Sequence      

MKRREIGVSVYPDLRPLDEIRDYLKLAAKYGCTRVFSSMFSVEGTNEEIINYFRDFIKAA
HEVGMKVSLDVNPNFMAKIGADYDDISLFHEIGCDIIRMDMSYGKEKDLVLCDNPYGIQI
QLNASFKAGEEAAFLKENGIGPDQLMFGHNFYPQRYTALKWKNFLDTNKALEKYGYPIEA
FVSSTAPNTHGVWDARDGLPTVEKLRDLPIDLQARILFGTGNVENLLIGNAYATEEEFKA
LKGVLDEPRKMEDSPMYELYKKMGFPMKEMDEEKVLKVNLEKDISENERWMLMEFYPLSD
MGDSSEWIWRSRNGRFLNKNKPIEPRVYEGEYFPVGSVLIVNDNYKHYAGEIQIARREIR
NDGQRNIVARLAPHEEEMLEMINDGDFVRFVEA

Enzyme Prediction     

No EC number prediction in MGYG000001826_00280.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH170	5	246	1.9e-65	0.6657142857142857

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam19200	DUF871_N	5.27e-80	6	242	1	234	DUF871 N-terminal domain. This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.
COG3589	COG3589	2.74e-69	4	393	2	359	Uncharacterized protein [Function unknown].
pfam05913	DUF871	2.91e-22	275	391	2	116	Bacterial protein of unknown function (DUF871). This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.
cd00551	AmyAc_family	0.001	29	82	58	112	Alpha amylase catalytic domain family. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; and C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost this catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
smart00642	Aamy	0.005	20	80	56	99	Alpha-amylase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT30117.1	2.30e-127	5	392	4	393
AMK55490.1	1.46e-94	1	393	15	409
BBH25090.1	3.50e-87	5	385	3	356
QAT39807.1	5.59e-80	4	391	2	361
QNM14116.1	3.05e-79	6	379	4	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1X7F_A	2.30e-57	4	382	27	375	Crystalstructure of an uncharacterized B. cereus protein [Bacillus cereus ATCC 14579]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001826_00280.